KEGG   Rhizobium jaguaris: CCGE525_13810Help
Entry
CCGE525_13810     CDS       T05891                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00330  Arginine and proline metabolism
rjg01100  Metabolic pathways
rjg01110  Biosynthesis of secondary metabolites
rjg01130  Biosynthesis of antibiotics
rjg01230  Biosynthesis of amino acids
Module
rjg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CCGE525_13810
Enzymes [BR:rjg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CCGE525_13810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA TrkA_N
Motif
Other DBs
NCBI-ProteinID: AYG59760
UniProt: A0A387FK52
LinkDB All DBs
Position
complement(2829170..2830009)
Genome map
AA seq 279 aa AA seqDB search
MATEASSSAFASSDPIILIGAGNMGGALLTGWLKSGVPGSSVIVVDPKPSEPMLKLIADA
GASHVAGVPTDITAGVLFIAVKPQVMEAVLPPFKTTIGPNTVVVSIAAGKTLAFLEKHLG
EMAMVRAMPNTPAMVGRGVTGAFANAQVGEPQRQLVQNLLKVSGPVEWVPEEADIDSVTA
VSGSGPAYVFYLVECMAEAGRKLGLQADLAMRLARETVAGAGELLHQSPDDASRLRQNVT
SPGGTTAAALAVLMAEDGMQPLFDEAIEAARKRAQELAG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagaagcatcatcgagcgcttttgcatcctccgaccccatcatcctgatcggg
gctggcaatatgggcggcgctctgctgacgggttggctgaaaagcggtgtgccgggctct
tcggtgatcgtcgtcgatcccaagccgtccgagccgatgctgaagttgatcgccgatgcc
ggcgcgagccatgtcgcaggcgttccgactgacatcactgccggcgttctcttcattgcc
gtcaagccccaagtcatggaggcggtattgccgccattcaagacgacgatcggaccgaat
accgtggtggtgtcgatcgctgccggcaagacgctggctttccttgaaaagcatctaggt
gaaatggcgatggtgcgcgccatgccgaacacgccggccatggtcggtcggggcgtaacc
ggtgcgtttgccaacgcccaagtcggcgagccccagcggcagttggtgcaaaatctcttg
aaggtatccggtccggtcgaatgggtgccggaggaagccgatattgattccgtgacggcc
gtctccggcagcggaccggcctatgttttttatctcgtcgagtgcatggcggaggcgggc
cggaagcttggcctgcaggcggacctcgccatgcgactcgcgcgagaaactgtcgcgggg
gctggtgagttgttgcatcagtcccccgatgacgcttcgcgtcttcgccagaacgtgacg
tctcccggcggtaccaccgccgccgcccttgccgttctgatggcggaagacggcatgcag
cctctattcgacgaggcgatcgaggcagcgcgcaagcgtgcgcaggaactggccggttag

DBGET integrated database retrieval system