KEGG   Rhizobium jaguaris: CCGE525_19450Help
Entry
CCGE525_19450     CDS       T05891                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rjg01100  Metabolic pathways
rjg01110  Biosynthesis of secondary metabolites
rjg01130  Biosynthesis of antibiotics
rjg01230  Biosynthesis of amino acids
Module
rjg_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCGE525_19450
Enzymes [BR:rjg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CCGE525_19450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 AAA Cytidylate_kin AAA_16 TsaE Exotox-A_cataly AAA_8
Motif
Other DBs
NCBI-ProteinID: AYG61557
UniProt: A0A387FUT4
LinkDB All DBs
Position
complement(3989361..3989951)
Genome map
AA seq 196 aa AA seqDB search
MSEQVLTLAESLRDRARVVLGTRNLVLVGLMGAGKSSIGRLVAHQLGIPFVDTDIEIERV
SRMTIAELFEAYGEAEFRALETRVIKRLLKGGPRVVSTGGGAFINERTRRHVKRSGLSIW
LKADLDVLWDRVSKRDTRPLLKTENPKQTLENLMNARYPIYAEADLTVLSRDVGKDVMVK
EVLAAIVEGKEESKTP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaagtgctgacccttgcagaaagccttagagacagagcgcgcgtcgttttg
ggcacgcgcaatcttgtcctcgtcgggttgatgggggcgggaaaatcctcgatcggccgg
ttggtcgcgcatcagctcggcattcccttcgtcgatacggatatcgagatcgaacgcgtg
tcgcgcatgacgattgccgagctgttcgaggcttacggtgaagcggagttccgggcgctg
gaaacgcgggtgatcaagcggttgctcaagggcggcccccgtgttgtttccaccggcggc
ggcgccttcatcaacgagcgtacgcgccgacacgtcaaacggagcggcctgtcgatctgg
ctgaaggccgatctcgacgtgctctgggatcgcgtcagcaagcgcgacacccggccgctg
ctcaaaaccgagaatccgaaacagaccctcgaaaatctgatgaacgcgcgctatccgatc
tatgcggaagccgatctcacggtcttatcccgcgatgtgggcaaagatgtcatggtcaag
gaagtccttgccgccatcgtcgaggggaaagaagaaagcaagacaccatga

DBGET integrated database retrieval system