KEGG   Rhizobium jaguaris: CCGE525_19645Help
Entry
CCGE525_19645     CDS       T05891                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00564  Glycerophospholipid metabolism
rjg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CCGE525_19645
Enzymes [BR:rjg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CCGE525_19645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 NAD_binding_8 FAD_binding_2 FAD_oxidored GIDA 3HCDH_N STPPase_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AYG61561
UniProt: A0A387G038
LinkDB All DBs
Position
4031202..4032713
Genome map
AA seq 503 aa AA seqDB search
MSEQIYDIFVIGGGINGCGIARDAAGRGYKVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREVLWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PPTAVLNMKTDPAGKPLKALFTKAFEYSDGWVDDARMVVLNARDAADRGATIMPRTKVIS
ARRERAAWTIETQDTITGEKRAFQSRMLVNAAGPWVDHVLSDAFGKNQVHNVRLVQGSHI
IVRKKFDDPRAYFFQNPDNRIIFAIPYEQDFTLIGTTDRDYKDDPKDVKISEDETTYLCN
AASEYFKEPVRREDIVWTYSAVRPLYDDGASKAQEATRDYVLKVEGAEGQAPLLNVFGGK
LTTYRRLSEHALEKIGEAIGLKGMPWTAKSSLPGGDFPVRGYEAEVAKLKGRYPFLADPH
ARRLVRRYGTRAAMILGEAKMAADLGRSFGSDLYEAEVRYLMAHEWAYTAADVLWRRSKK
GLYLSKDEAAALDDYMAGTRVHA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcagatctacgatatcttcgttatcggcggcggcatcaatggctgcggcatc
gctcgtgacgctgccgggcgcggttacaaagttgcgcttgcggaaatgaatgattttgca
tccggcacgtcttccggcgccaccaagctcatccatggcggcctgcgctacctcgaacat
tacgaattccgccttgtgcgagagtcgctgatggagcgcgaagtgctctgggcgatggcg
ccgcacatcatctggccgttgcgtttcgtcctgccctatcacaagggcggcatccgcccg
gcctggctcatacgtctgggcctcttcctctatgatcacctcggcggccgcaagctgctg
ccgccgacggcggtgctgaacatgaaaaccgacccagcgggaaaaccgttgaaggcgctg
ttcaccaaagccttcgaatattccgacggctgggtggacgatgcgcgcatggtcgtgctc
aacgccagggacgctgccgatcgcggcgcgaccatcatgccgcggaccaaggtaatttcc
gcccgtcgcgagcgcgccgcctggacaattgaaacccaggacaccattactggcgaaaaa
cgcgcgttccagtcgcgcatgctggtcaacgctgccggcccctgggttgaccatgttctg
tccgacgccttcggcaagaaccaggtgcacaatgtccgcctggtgcagggcagccacatt
atcgtccgcaagaagttcgacgacccacgggcctatttcttccagaatccggataaccgc
atcatcttcgccatcccctacgaacaggatttcaccctgatcggcacgacggaccgcgac
tacaaggatgatccgaaggatgtgaagatctccgaggatgagaccacctatctttgcaat
gccgccagcgaatatttcaaagagccggttcggcgcgaggatatcgtctggacctactcg
gccgtacgtccgctctatgatgacggcgcctccaaggcgcaggaagcgacgcgcgattat
gtgctgaaggtcgaaggggctgaggggcaggcaccgttgctcaacgtcttcggcggcaaa
ctcactacctatcgtcgcttaagcgaacatgcgctggaaaagatcggggaggccatcggc
ctcaagggcatgccctggacagccaagagttcccttccaggcggcgattttccggtccgg
ggctatgaggcggaggtcgccaagctgaaggggcgctatcctttcctcgccgatccgcat
gcgcgcaggctcgtgcgccgttatggcacccgcgccgccatgatccttggagaagcgaag
atggcggccgatctcggccgcagtttcggcagcgatctctacgaagcggaagtccgctat
ctcatggcacatgaatgggcctacaccgccgccgacgtcctctggcgccgttcgaaaaag
ggtctctatctctccaaggacgaagccgccgcacttgatgactatatggctggcacgcgc
gttcatgcctga

DBGET integrated database retrieval system