KEGG   Rhizobium jaguaris: CCGE525_27605Help
Entry
CCGE525_27605     CDS       T05891                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CCGE525_27605
Enzymes [BR:rjg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CCGE525_27605
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CCGE525_27605
    1.1.1.-  
     CCGE525_27605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AYG62529
UniProt: A0A387FV18
LinkDB All DBs
Position
pRCCGE525c:1144805..1145878
Genome map
AA seq 357 aa AA seqDB search
MKAVRYYSKKDIRVEDVPAPSGPLGDDMVLIEPLVCGICGTDLHEYIAGPIVTPATPNVY
SGATLPQILGHEFSARVLEVGKNVTHVSPGSRVSIQPLVSPRDDYYGRRGLFHLSEKMAV
VGLSWDWGGMGERAVINGYNAIPVPDTVSDVQAAMIEPAAVALYGVDRGRVTSGSSVLVS
GVGPIGALVLLAAKAAGATKIFVSELNPNRRALAQQLVPEAVVFDPRETDTDKLFRDQTE
EGVGVDVALECVGAEASLNLCAKAVRRRGTVVQVGLHVKPASVDAMLWALKDITVEATWC
YPVQIWPRIASMIGTGIFPVEKVVTAQIAPEDVVEKGFEALLDPKATHMKILVNMKA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtacgatattactccaagaaagacatccgggtcgaagatgtgccagcgcca
agtggcccgctcggcgacgatatggtgctgatcgagccgttggtctgcggcatttgcgga
accgacttgcatgagtacatcgcgggaccgatcgtgacgcccgccacgcccaatgtctat
tctggcgccaccctgccgcagatcctcggccatgaattttctgccagggtcttggaggtg
ggcaagaatgtgacgcacgtttccccaggttcgcgtgtgtccatccagccgctcgtctcg
ccgcgcgacgattattacggccggcgcggcctgttccacctcagcgaaaagatggcggta
gtggggttgtcctgggattgggggggcatgggcgaacgagcggtcatcaatggctacaac
gccattccggtgccggacacggtctcggacgttcaggcggccatgatcgagccggccgcc
gtcgcgctctacggtgtcgaccgcggcagagtgaccagcggcagcagtgttctcgtttcc
ggcgtcggcccgatcggcgcgctggtcctgctggcggccaaggcggccggtgcgacaaag
atcttcgtgtccgagctcaatccgaaccgtcgcgctttggcgcaacagttggtcccggaa
gcggtcgtcttcgatccgcgcgaaacggatacggacaagttgttccgcgatcagacagag
gagggcgtgggcgtcgacgtggcactcgaatgtgttggtgccgaggcgtcgctcaacctt
tgcgccaaggccgtgcgtcgtcgcggcaccgttgtgcaggtcggcctgcatgtgaagccg
gcttctgtcgacgcgatgctttgggcgctgaaggatatcaccgttgaggcgacgtggtgc
tatcccgtgcagatctggccccgcatcgcctcgatgatcggcaccggcatcttcccggtc
gaaaaggtcgtcacggcgcagatcgcgccggaagacgtggtcgaaaaaggcttcgaagca
ctgctcgatcccaaggccactcacatgaagatcctcgtgaacatgaaagcctga

DBGET integrated database retrieval system