KEGG   Rhizobium jaguaris: CCGE525_31105Help
Entry
CCGE525_31105     CDS       T05891                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
rjg  Rhizobium jaguaris
Pathway
rjg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CCGE525_31105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rjg02000]
    CCGE525_31105
Transporters [BR:rjg02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CCGE525_31105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_16 AAA_22 AAA_29 DUF87 AAA_25 Sigma54_activat RsgA_GTPase AAA_30 FtsK_SpoIIIE TniB NACHT NB-ARC AAA_23 AAA_24 AAA_33 SbcCD_C AIG1 AAA_19 DUF3987 MMR_HSR1 Hpr_kinase_C ABC_ATPase AAA PRK
Motif
Other DBs
NCBI-ProteinID: AYG63142
UniProt: A0A387G5E5
LinkDB All DBs
Position
pRCCGE525c:complement(1924098..1925840)
Genome map
AA seq 580 aa AA seqDB search
MSPLLSVSDLQVGFGRNPEANRVVHGVNFDLAAGETLAIVGESGSGKSVTALSINRLVDF
GGGRIIGGSIKLKRTDNSVLDLTTATEAELTKIRGAEIGMIFQEPMTSLNPVLTIGTQIE
ESFRLHRGLTGRQATAAAKDALDRVRIPDAARRLKYCPNQLSGGMLQRVMIATALACNPR
LLIADEPTTALDVTVQAQIMALLAELKRETGMSMIFITHDIGLVAGIADNVMVMQAGRAV
EQGELNQILDSPSHPYTQHLLHSVPHFSAGRAARSDFSRDDSAKAAPALEVDGLTVRFPV
SGSFFHRPTGEVHAVEGVGFDLLAGETLAIVGESGSGKSTTARAILGLVKSTRGTFTAKT
GKAADRTSAVQMVFQNPYASLNPRLRVDSILAEPIIAAGGRASGETRNRMAMLLKRVGLP
ENSLERYPHEFSGGQRQRLCIARALMLNPSVLVLDEAVSALDVSVQAQVLDLLIELQREY
RLAYLFISHDMAVVERIAHRIAVIYAGQIVEIGDAMSVLSRPKHSYTKRLISAVPTVDRR
RENFVVDTRQVPSLVRPLGFEPTAPEWRRFAPDHMAQAEA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
gtgagccctctgctttccgtttccgatctgcaagtgggctttggccgcaatccggaagcc
aacagggtcgtccacggtgtcaacttcgatctcgctgccggcgagacgctagcgatcgtc
ggcgagagcggttcggggaaatcggtgaccgcgctgtcgatcaaccgcctcgttgatttc
ggcggcggccgcatcatcggcggctcgataaagctgaagcggaccgacaacagcgttctc
gacctgacgacggcgaccgaagcggaattgacgaaaatccgtggcgccgagatcggcatg
atcttccaggaaccgatgacctcgctcaatccggtgctgaccatcggcacgcagatcgaa
gagtcattccgtctgcatcgcggcttgaccggccgccaggccaccgccgctgcaaaggat
gcgctggatcgcgtccgcatcccggatgccgcacggcggctaaaatattgcccgaaccag
ctctccggcggcatgctgcagcgtgtgatgatcgcgaccgcgctcgcctgcaatccgcgc
ctgctgatcgccgacgagccgaccacggcgctcgatgtgacggtgcaggcgcagatcatg
gcgcttcttgccgagctgaagcgcgagaccggtatgtcgatgatcttcatcacccacgat
atcggtcttgttgcaggcatcgccgacaatgtcatggtgatgcaggccggccgggcagtc
gaacagggcgagctcaaccagatcctcgatagtcccagccatccttatacgcagcatctt
ctccattccgttccccacttttcggccggccgcgcggcgcgatccgattttagccgtgac
gacagcgcgaaagccgcaccagcgctggaggtcgatgggctgaccgttcgctttccggtg
tcgggcagcttctttcaccgtccgaccggcgaggtgcatgcggtcgaaggcgtcggtttc
gatctgttggccggcgagacgctggcgatcgtcggcgaaagcggctcaggcaaatccacc
acggcgcgggcaatccttggattggtcaagtcgacgcgcggcacgttcacggcgaaaacc
ggaaaggcggcagatcgcacgagtgccgtgcagatggtgtttcagaatccctatgcctcg
ctcaacccacgacttcgggtcgatagcatcctggccgaacccatcatcgccgccggaggc
cgtgcatcgggggagacgcgcaacagaatggccatgttgctgaaacgcgtcggcctgccc
gaaaacagccttgaacgctatccgcatgagttttcgggcggtcaacgccagagactgtgc
atcgcgcgggcgctgatgttgaacccttcggttctagtactggacgaggctgtctcggcg
ttggacgtctccgttcaagcgcaagtcctggacctgctgatcgaattgcagcgcgagtac
cggcttgcctatcttttcatctcgcacgacatggccgttgtcgagcggattgcccatagg
atcgcagtgatctatgcgggccagatcgtcgagatcggcgatgccatgtcggtgctgtcg
cggccgaagcattcctataccaagcggctgatctccgcggtgccgacggtcgatcgacgg
cgcgagaatttcgtggtggacacgcgccaggtcccttcgctggtacgcccgctcggtttc
gagccgactgcacctgaatggcgccggttcgctccggatcatatggcccaggcggaagct
tga

DBGET integrated database retrieval system