KEGG   Rhodoluna lacicola: Rhola_00008730Help
Entry
Rhola_00008730    CDS       T03203                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rla  Rhodoluna lacicola
Brite
KEGG Orthology (KO) [BR:rla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rla01001]
    Rhola_00008730
Enzymes [BR:rla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Rhola_00008730
Protein kinases [BR:rla01001]
 Serine/threonine kinases: Other
  Bacterial family
   Rhola_00008730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kinase-like ABC1
Motif
Other DBs
NCBI-ProteinID: AIC47675
UniProt: A0A060JG54
LinkDB All DBs
Position
888540..890480
Genome map
AA seq 646 aa AA seqDB search
MPDLAGRIIGERYRVEQIVARGGMATVYLAVDLRLERKVALKIIHPHLANDISFRDKFIR
EARIAAKLSHPNLVNVFDQGEDGDMAFMAMEFVSGITLRDALKDFGALDWKRALDLFEPM
LSGLAAAHRAGILHRDLKPENVLLADDGRIKLGDFGLARDIDNNTATGSLVGTVAYLSPE
LVMRGTADARSDVYAAGIMLFEMLAGRQPFEGEQAVQIAYQHANDNVPAPSKYNPNVPPL
LDELVLWATARDAAHRPNDAVELLAVVQRAKAELKAGRKDTAIGIPTVNSSNLNSTTVMP
TVANDATQILNPDISRLDADDTRVISDLGNFNQTAVLDDLGYTDQQLNPLEEIGRKRRGF
GILITTLLIVLLGAGSGWWFSSGPGGLNFIPNLTSRTADEAQVTLSNLKANIAIAEENSA
TVAKGLVIRTDPAAGSFFFGGTITVYVSSGPRLVNAPNLLGLNLAEATAEIVKAGFSLGE
VTSAFNEAPLGKVFDYLGADGNQIPETSKINLSVSLGAIPVVAGLEQEAAVAAIQAVGLK
INEITEDYSDTIAAGQVISLIPQSEPLGKNGTVNLVVSKGPNIVTVPNMIGQTVLAAKAA
LESLGLRVVVNTDQLTTRWGVVPVKRQSAAAGTQMRVGDSITISTR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatctagcgggccgaataatcggtgaaagataccgagtagagcagattgttgct
cgaggtgggatggcaaccgtctatctagcagtggatttgagactggaacgcaaagttgcg
ttgaaaatcattcatccgcaccttgcgaacgacatctcattcagagacaaattcatcaga
gaagcgcgcattgccgcgaaactttcacaccccaatttggtaaatgttttcgatcaaggc
gaagatggcgacatggcgttcatggccatggaatttgtctcaggcataacactgcgggat
gccctcaaagattttggcgctttagattggaaacgcgcgctggatctttttgaaccgatg
ctcagtggcctagctgcagcgcatcgcgctggcattttgcaccgcgatctaaaacctgag
aatgttttgcttgctgatgatggccgaatcaaacttggcgactttggattagccagagac
attgataacaacaccgctaccggttcgctggtaggcaccgttgcctacctgtcaccagaa
cttgtgatgcgcggaaccgccgatgccagaagcgatgtgtatgcggccggcattatgctc
tttgaaatgcttgccgggcgacagccttttgagggtgagcaagcggttcagattgcctac
cagcacgcaaacgacaacgttccggctccgtcaaaatacaacccaaacgtgccaccgctg
ctggatgaattggtactgtgggccaccgctcgcgatgctgcacatcgacctaacgacgcc
gttgaattactggcagttgttcaacgcgcgaaagctgaacttaaagcaggtcgcaaagac
acggccattggtattcccacggtcaattcttcaaacctcaacagcacaaccgtcatgcca
actgtcgccaatgacgccacgcaaattctgaacccagatatttcaagacttgatgcagat
gacacccgggtaatttcagatctaggaaatttcaatcaaactgcagttctggatgacctt
ggctacaccgatcaacagctgaatcccctagaagaaatcgggagaaagcgtcgtggattt
gggattttgattaccactctgctcatcgttctacttggcgcaggttctggttggtggttc
agcagcggcccgggtgggttgaactttattcctaatctcaccagccgaacagccgatgaa
gcgcaggtgaccctttcaaatctcaaagcgaacatagctatagccgaagaaaattcagcc
accgtagcaaaggggctagtgattagaacagatcctgcggctggttctttcttctttggc
ggaacaatcaccgtctatgtttcgagtggcccccgtttggtcaacgcaccaaacctgctt
ggcctaaacctggctgaagcaactgctgaaattgtcaaggcaggattcagtctcggcgaa
gttacctcagcatttaatgaagctcccctaggaaaagtttttgattaccttggggcggat
ggaaatcaaattccagagaccagcaaaataaatctttcggtttcactcggtgcgatacca
gttgttgctggattagaacaagaagcagcagtagcagcaatccaggcagtgggcctgaag
atcaacgaaatcaccgaggactacagcgacacaatcgccgccggtcaggtgattagtctg
atcccgcagtccgaaccgctaggtaaaaacggaacggtcaatcttgtagtttcaaaaggc
cctaacatcgtgacggtgcctaacatgattgggcaaacggttcttgcagccaaagcggca
ctagaaagtcttggcttgagagttgtggtaaatactgatcaactaacaactagatggggc
gtagttccagtcaaacgacagagtgcggcggctggaacgcaaatgcgggttggcgattca
ataaccatctcaacaaggtaa

DBGET integrated database retrieval system