KEGG   Rhodoluna lacicola: Rhola_00011550Help
Entry
Rhola_00011550    CDS       T03203                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rla  Rhodoluna lacicola
Pathway
rla00020  Citrate cycle (TCA cycle)
rla00190  Oxidative phosphorylation
rla00650  Butanoate metabolism
rla01100  Metabolic pathways
rla01110  Biosynthesis of secondary metabolites
rla01120  Microbial metabolism in diverse environments
rla01130  Biosynthesis of antibiotics
rla01200  Carbon metabolism
Module
rla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rla_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rhola_00011550
   00650 Butanoate metabolism
    Rhola_00011550
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rhola_00011550
Enzymes [BR:rla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rhola_00011550
    1.3.5.4  fumarate reductase (quinol)
     Rhola_00011550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 DAO Pyr_redox_2 HI0933_like MCPsignal DUF573
Motif
Other DBs
NCBI-ProteinID: AIC47948
UniProt: A0A060JMY5
LinkDB All DBs
Position
1162621..1164396
Genome map
AA seq 591 aa AA seqDB search
MSKPKVHHYEYDVVIVGAGGAGMRAAIEAGPHAKTAVISKLFPTRSHTGAAQGGMAAALG
NVEEDSWEWHTFDTVKGGDYLVDQDAAEILAKESVQAVIDLENMGLPFNRTPDGKIDQRR
FGGHTRDHGKAPVRRSCYAADRTGHMILQTLYQNCVKLGIEFYNEFYVLDLVMTKVDGEE
RPSAVVAYELATGELHVFQGKSIIFATGGFGKIFKTTSNAHTLTGDGVGIIWRKGLPLED
MEFYQFHPTGLAGLGILLSEAARGEGGILRNSTGERFMERYAPTIKDLAPRDMVARAMAN
EVREGRGAGPNKDYVLLDLTHLPPEVIDEKLPDITEFARTYLGVEPYTEPVPVFPTAHYA
MGGIPTNVQAEVLRDNDTVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGKRAGAAAV
EYAKTAKHVPVPANAADEVISMIEKVRKSKGTEKVAVLRKELQDTMDKNAQVYRTEESLN
EALDKIAELRERYENISVQDKGQRFNTDLLEAIELGFLLDLAEVLALTSRERRESRGAHL
REDFLARDDEKFMVHSMAYLTDKPAKKPGDNIKVGWKPVIVTNYQPMERKY
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaagccaaaggttcatcactacgagtacgacgttgtaatcgtgggtgcgggtggt
gcaggaatgcgcgcggctatcgaagccggaccacacgcaaagaccgcagtaatttccaag
ctattccctactcgctcacacaccggtgcggcgcagggcggtatggctgccgctcttggc
aacgttgaagaagacagctgggaatggcacacctttgacaccgttaaaggtggcgactac
ctagttgatcaggatgcagccgagattcttgccaaggaatctgttcaggcggttattgac
ctcgagaacatgggtcttccgttcaaccgcacaccagacggcaagattgaccagcgtcgt
tttggtggccacactcgtgaccacggtaaggcaccggttcgtcgttcttgctatgcagca
gaccgcaccggtcacatgattctgcagaccctttaccagaactgcgtaaagctaggcatt
gagttctacaacgagttctacgttcttgacttggtgatgaccaaggttgatggcgaagag
cgtccatcggcagtggttgcctacgaacttgccaccggtgaactgcacgtgttccagggt
aagagcattatttttgccaccggtggattcggcaagattttcaagaccacatcaaacgca
cacacgctcacgggtgacggcgttggcatcatttggcgcaaggggcttccgcttgaagac
atggagttctaccagttccacccaaccggtcttgccggtctaggcatcttgctttcagaa
gctgcacgtggtgagggtggaatccttcgcaactcaaccggtgaacgcttcatggaacgc
tacgcaccaacaatcaaggacctagctcctcgtgacatggttgcccgcgcaatggccaac
gaggttcgcgagggtcgcggtgcaggtcctaacaaggactacgttctgctagacctgact
cacctaccgccagaagttattgacgagaagctgccagacatcaccgagtttgcccgcacc
tacctaggtgttgagccttacacagagccagtaccggtattccccaccgcgcactacgca
atgggtggtattccaaccaacgttcaggcagaggttcttcgcgacaacgacacagttgta
ccaggcctttacgccgccggtgaatgtgcctgcgtatcggttcacggtgcgaaccgtttg
ggcaccaactcgctgctagacatcaacgtgtttggtaagcgtgccggtgcggcagcggtt
gagtacgccaagaccgcaaagcacgttccggttccggccaacgccgccgacgaagtcatt
tcaatgattgagaaggttcgcaagtcaaagggcactgagaaggttgccgtgcttcgcaaa
gaacttcaggacaccatggacaaaaatgcacaggtgtaccgcactgaggaatcactcaac
gaggcacttgacaaaattgccgagcttcgcgagcgctacgagaacatcagcgttcaagac
aagggtcagcgcttcaacaccgatctacttgaggccattgaacttggcttcttgctagac
cttgctgaggtacttgcactcacttcacgtgagcgtcgcgaaagccgtggagctcacctt
cgcgaagacttccttgctcgcgacgatgagaagttcatggtccactcaatggcctaccta
actgataagccagccaagaaacctggcgacaacattaaggttggctggaagccagtcatt
gttaccaactaccagccgatggagcgtaaatactaa

DBGET integrated database retrieval system