KEGG   Rhodoluna lacicola: Rhola_00011560Help
Entry
Rhola_00011560    CDS       T03203                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rla  Rhodoluna lacicola
Pathway
rla00020  Citrate cycle (TCA cycle)
rla00190  Oxidative phosphorylation
rla00650  Butanoate metabolism
rla01100  Metabolic pathways
rla01110  Biosynthesis of secondary metabolites
rla01120  Microbial metabolism in diverse environments
rla01130  Biosynthesis of antibiotics
rla01200  Carbon metabolism
Module
rla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rla_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rhola_00011560
   00650 Butanoate metabolism
    Rhola_00011560
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rhola_00011560
Enzymes [BR:rla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rhola_00011560
    1.3.5.4  fumarate reductase (quinol)
     Rhola_00011560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4 Fer4_18 Fer4_4 Fer4_6 Fer4_15 Fer4_2 Fer4_16 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AIC47949
UniProt: A0A060JP26
LinkDB All DBs
Position
1164396..1165157
Genome map
AA seq 253 aa AA seqDB search
MATAVATKGNEFEQMGAIPTFQVTLFVRRFNPEDGQEARWEDFDVQVHGTDRVLDALHKI
KWEMDGSLTFRRSCAHGVCGSDAMRINGRNRLACKTLIKDLDITQPIYVEPIKGLAVEKD
LVVDMNPFYQAYKDINPFLIASDKPEKERLQSAEQHSKFEDTTKCILCAACTTSCPVFWT
DGQYFGPAAIVNAHRFIFDSRDEGSELRLDILNDKEGVWRCRTTFNCTDACPRGIEVTKA
IAEVKQAILRGKA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcagtagctactaaaggaaacgaattcgaacaaatgggtgccatcccaacc
ttccaggtcaccctctttgtgcgtcgcttcaatccagaagacggccaagaggctcgttgg
gaagactttgacgttcaggttcacggcaccgaccgcgttcttgacgccctacacaagatc
aagtgggagatggacggttcgctaaccttccgtcgttcatgtgctcacggagtttgtggt
tcagatgcaatgcgtatcaacggccgcaaccgcttggcatgtaagaccctgatcaaggac
cttgacatcactcagccaatttacgtggagccaatcaagggtcttgcggttgagaaggat
cttgtcgttgacatgaacccgttctaccaggcctacaaagacatcaacccgttcctaatc
gcaagcgacaagccagagaaggaacgcctgcagtcagcagagcagcactcaaagtttgaa
gacaccaccaagtgcattctttgtgctgcgtgtactacttcttgcccagtgttctggaca
gacggtcagtactttggtccggcggcaattgtgaacgcacaccgcttcatctttgactct
cgcgatgagggctccgagcttcgcctagacatcttgaatgacaaagagggtgtgtggcgc
tgccgcaccaccttcaactgcaccgatgcctgccctcgtggaattgaagtcaccaaggca
atcgccgaagtgaagcaggccatcctaagaggcaaggcctaa

DBGET integrated database retrieval system