KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_00665Help
Entry
RLEG3_00665       CDS       T03009                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00564  Glycerophospholipid metabolism
rlb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RLEG3_00665
Enzymes [BR:rlb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RLEG3_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AHF88716
UniProt: W0IVH8
LinkDB All DBs
Position
unnamed5:complement(131968..133479)
Genome map
AA seq 503 aa AA seqDB search
MGRNIHDIFVIGGGINGCGIARDAVGRGYTVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PPTSVLDMRSDPAGKPLKALFSKAFEYSDGWVDDARMVVLNARDAADKGALIMPRTKVVS
ARRENGLWQIETVDTVTGRNDSHQARMLVNAAGPWVDHVIRSAFGQNEAHHVRLVQGSHI
VVKKKFDDVRAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPRDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLEGEGAAPLLNVFGGKL
TTYRRLSEHALEKIGAAIGAKGAPWTAKSHLPGGDFAVKGYETEVAKLKRRYSFLADRHA
RRLVRRYGTRAEALLGDASGIDDLGRLFGGDLYEAEVTYLVEHEWARHAEDVLWRRTKDG
LRLSKEQAQSLEEYMAAMPAMAG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgaaatattcacgacatattcgtcatcggtggcggcatcaacggttgcggcatt
gcgcgcgatgccgtcgggcgcggctatacggtggcgctggcggagatgaacgatttcgcc
tcgggtacctcgtcgggcgccaccaaactgatccatggcggcctgcgttacctcgagcat
tacgagtttcgtctggtgcgtgaatcgctgatggagcgcgagatcctctgggcgatggcg
ccgcacatcatctggccgctgcgtttcgtgctgccctaccacaagggcggtattcgcccg
gcctggctgatccggctcggcctcttcctctacgaccatcttggcggccgcaagctgttg
ccgccgacatcggtgctcgacatgcgcagcgatccggccggcaagccgctgaaggcgctg
ttttccaaggccttcgaatattccgacggctgggtcgacgatgcccgcatggtggtgctg
aacgcccgcgacgccgccgacaagggtgcgctgatcatgccgcgcaccaaggtggtgtcg
gcaaggcgcgagaatggcctgtggcagatcgagaccgtcgatacagtcaccggtcgcaat
gacagccatcaggcccgcatgctggtcaatgctgccggtccctgggtcgaccatgtcatt
cgttccgccttcggccagaacgaagcccaccatgtccgcctcgtccagggcagccatatc
gtcgtgaagaagaaattcgacgatgtgagagcctatttcttccagaatcccgacaaccgc
atcatcttcgccattccctatgagggcgatttcaccctgatcggcaccacggatcgcgac
tacaccgccgatccccgggatgtccggatatcagaggaggagaccgtttacctctgcaat
gcggcgtcagaatatttcaaggagccggtccggccggaggatatcgtctggacctattct
gcagtcagaccgctttatgacgacggcgcctcgaaggcgcaggaggcgacgcgcgactat
gtgctgaagttggaaggcgaaggtgccgcgccgctgctcaacgtcttcggcggcaagctc
accacctatcgtcggctttccgaacatgcgctggagaagatcggtgccgcgatcggcgcc
aagggagccccgtggacggccaaaagccatctgccgggcggcgactttgcggtcaagggt
tacgagacggaggtcgccaagctgaaacggcgttattcgttcctcgccgatcggcatgcc
cgccggctggtgcgccgctatggcaccagggccgaggcgctgcttggcgatgccagcggc
atcgacgatctcggacggctgttcggtggcgatctctacgaggcagaggtcacctatctc
gtcgaacatgaatgggcccggcacgccgaagacgtgctgtggaggagaacaaaggatggt
ctgcgcctttcgaaggagcaggcccagtcactggaggagtacatggctgccatgccggcg
atggccgggtag

DBGET integrated database retrieval system