KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_02365Help
Entry
RLEG3_02365       CDS       T03009                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00910  Nitrogen metabolism
rlb02010  ABC transporters
Module
rlb_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    RLEG3_02365
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RLEG3_02365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlb02000]
    RLEG3_02365
Transporters [BR:rlb02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    RLEG3_02365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AHF88550
UniProt: W0IRA9
LinkDB All DBs
Position
unnamed4:complement(222589..223482)
Genome map
AA seq 297 aa AA seqDB search
MSALANKENPSTVATATPAAKVLPFSGKHGSRIDFRRAALTALRNVVPPVVVLALILLVW
QVLCSSADASLPSPHRVWQDSYDLIAYPFFNYGSQDIGLGWRVLISLQRVLYGFGLAAVT
GVIIGAIIGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDSNPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVAEVLRLNQFEFFWKIMLPSAAPYIFTGLRIGVGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGIVGFALDKLVAALGKLITRGAMAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccctggcaaataaagaaaatccctccacggtcgccactgccacgccggcggca
aaagttctgccattttccggcaaacacggatcgcggatcgattttcgtcgagcggcactg
accgcccttcgtaatgtcgttccgccagtcgtcgtgctggcactcatcctgctcgtctgg
caggtgctctgttcgtcggcggatgcgtctttgccctcgccgcatcgggtctggcaggat
agctatgacctgatcgcctatccgtttttcaactacggctcccaggatatcgggctcggc
tggcgcgtgctcatttcgctgcagcgcgttctctatggcttcgggcttgccgcggtcacc
ggcgtcatcatcggtgcgatcatcggccagtcagtctgggcgatgcgtggcctcgatccg
atcttccaggtgctgcgtacggttccgccgctcgcctggctgccactgtcgctcgcagcc
ttccaggattccaacccctcggcgatcttcgtgatcttcattacgtcgatctggccggtg
attatcaacaccgccgtcggcgtccgcaatatcccgcaggattaccgcaatgtcgccgag
gtgctgcgcctcaaccagttcgagtttttctggaagatcatgctgccttcggcagcgcct
tacatcttcacaggcctcaggatcggcgtcggcctctcctggctcgccatcgtcgcggcc
gaaatgctgacgggcggcgtcggcatcggcttcttcatctgggacgcatggaactcgtcg
cgccttccggacatcatcgtcgcgctcgcctatatcggcatcgtcggcttcgccctcgac
aagctggtggcagcactcggcaaactcatcacccgcggcgccatggccaactga

DBGET integrated database retrieval system