KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_02815Help
Entry
RLEG3_02815       CDS       T03009                                 

Definition
(GenBank) peptide ABC transporter ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RLEG3_02815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlb02000]
    RLEG3_02815
Transporters [BR:rlb02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    RLEG3_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 oligo_HPY SMC_N AAA_16 AAA_29 DUF87 NACHT AAA_33 AAA_23 NB-ARC Sigma54_activat MMR_HSR1 RsgA_GTPase ATP_bind_1 Mg_chelatase CbiA AAA_24 Zeta_toxin ATP-synt_ab DUF3987 AAA_15 G-alpha
Motif
Other DBs
NCBI-ProteinID: AHF88031
UniProt: W0ITF8
LinkDB All DBs
Position
unnamed3:complement(53027..54691)
Genome map
AA seq 554 aa AA seqDB search
MSGPETEKPPLLDVKDLCVSFGGFAAVKNVSFTLQPGEILGIVGESGSGKSVTCRAVMRL
LSATARADGTVKLDGRNLLTFGDDELCAIRGRDIGMIFQNPASHLDPLRRIGQQVAAPMI
RHLGIGKREGLQRAIKLLEDVGIREPEKRARSYPHEFSGGMKQRAMIAAAIGCQPKLLIA
DEPTTALDVTVQARILELLKELNRKSGLAMILISHDLGVVADICSRVVVMRHGEVVEQGL
IDDVINRPRHPYTRLLIDSQPGRKNYGMAVDPDQATPLLHVENLSVTFPFGKSLLDNFGT
DNSFRAIDGIDLKINTGETVGIVGESGSGKSTLARSIIRLNTPSGGAIRLEGKDVGALRG
EALTAFRRRVQMVFQNPYDSLNPRLTIAEAVAEPIWRHGIADRKEARKEADLLLDMVELP
SSLRDRRPQQLSGGQCQRVGLARALALKPQLLIADEITSALDVTTQAQILELLVRIQRER
SLTLLYISHDLAVVSSLCHRVYVFKAGRVVEQGVARQVLCTPQDPYTQALVGSLARLPSA
RTIPPSQPVVTHAP
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggccggaaacggagaagccgccgctgcttgacgttaaggatctctgcgtcagc
ttcggtggcttcgcagcggtgaagaacgtatcgttcacgcttcagccgggagaaatcctc
ggcatcgtcggcgaaagcggttcgggcaaatccgttacctgccgcgccgtgatgcggctg
ttgtcggctacggcacgcgccgacggcacggttaagctcgacggacgcaacctgctgacg
ttcggcgacgacgagctgtgtgccattcgcggccgcgacatcggcatgatcttccagaac
ccggcatcgcatctcgatccactgcgccgcatcggtcagcaggtcgcggcgccgatgatc
cgtcacctcgggattggtaagcgcgaaggcttacaacgcgcgatcaagctgctggaggac
gtcggcatccgcgagccggaaaagcgcgctcgctcctatccgcacgagttttctggcgga
atgaaacaacgggcgatgatcgccgctgcaatcggttgccagccgaagctgttgatcgcc
gacgagccgacgaccgctctcgacgtcacggtgcaggcacgcatcctagaactgctcaag
gagctcaatcgaaagagcgggctggcgatgatcctgatttcgcatgatctcggcgtcgtc
gcggatatctgctcgcgcgtcgtggtcatgcgtcatggcgaggtggtggagcagggactg
atcgacgacgtcatcaaccggccacgccacccctatacaaggctactgatcgattcccag
cctggccgcaagaactatggcatggcggtcgatccagatcaggcaactccgctgctccac
gtcgaaaacctttcggtgacgttccccttcgggaagagcttgctcgacaatttcggaaca
gataattccttccgggccatcgacggcatagatcttaagatcaataccggcgaaacggtt
ggtatcgtcggcgaaagcggctccggcaagagcacgctcgcccgttcgatcattcgcctg
aacacgccgagcggcggcgcgatccgcctggaggggaaggatgtcggcgcgctccggggg
gaggcgctgacggcgttccgtcgccgtgtgcagatggtgttccagaacccgtacgattca
ctcaatccacgcctgaccatcgccgaagccgtcgccgagccgatctggcgacatggcatc
gcggaccgaaaggaggctcggaaagaagccgacctcttgttggatatggtggagttgccg
agcagcctgcgcgatcgccggccacagcagctttccggcggccaatgccagcgcgtcggc
cttgcccgagcgttggcgctgaagccgcagcttctcatcgccgacgaaatcacctcggcc
ctcgatgtcacgacgcaggcgcagatcttggaattgctcgtgcggatccagcgtgagcgc
tcgctgacgctgctctacatctcgcacgatctcgccgtagtgagcagtctgtgccaccgc
gtctatgtcttcaaagccgggcgcgtcgttgagcagggagtggcgcggcaggtcctgtgc
acgccgcaggacccttatacgcaggcgctggtcggctcgttggctcggctgccgtcggct
cggacaattcccccttcgcaaccggtagtgacccatgcgccttga

DBGET integrated database retrieval system