KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_14950Help
Entry
RLEG3_14950       CDS       T03009                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RLEG3_14950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlb02000]
    RLEG3_14950
Enzymes [BR:rlb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RLEG3_14950
Transporters [BR:rlb02000]
 Other Transporters
  Pores ion channels [TC:1]
   RLEG3_14950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: AHF83033
UniProt: W0IAF1
LinkDB All DBs
Position
997284..997904
Genome map
AA seq 206 aa AA seqDB search
MLTLYYAPGTCALASLIALEESGLAFEVKKISLRDGEQRSPDYLKINPKGRVPALVTDYG
VLTETPAILAYIAQSAPAARLAPLDDAFEFARLQSFNSYICSTVHVNHAHRPRGSRWADE
PAAIEAMKAKVPENMADCFTLIEQTMFEGPWVMGEAYSLADPYLFVMTDWLPSDGVDPAR
FKKASDHHARMLQRPAVQRALAYDRA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgacactctactacgcgccgggaacctgcgcgctcgcaagccttattgccctggaa
gaatccggcctggccttcgaagtcaagaagatcagtctccgcgatggcgagcagcgctcg
ccggactatttgaagatcaacccgaagggccgtgtgccggcactggtcaccgattatggc
gtgttgacggaaacgccggcgatccttgcctatatcgcccagagcgcgccggccgccagg
ctggcgccgcttgacgatgcttttgaatttgccaggctccagtccttcaacagctatatc
tgctcgaccgtgcatgtgaaccatgctcatcgcccgcgcggctcgcgctgggccgacgag
ccggcggcaatcgaggccatgaaggcgaaggtgcctgagaatatggccgattgtttcacg
ctgatcgagcagacgatgttcgaaggcccatgggtgatgggcgaagcctattcactcgcc
gatccctacctcttcgtcatgaccgactggctgccgtccgacggcgtcgatcccgcccgg
ttcaaaaaggcgagcgaccaccacgcccgcatgctgcagcgccccgccgtgcagcgggcg
ctggcctacgatcgggcctga

DBGET integrated database retrieval system