KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_15010Help
Entry
RLEG3_15010       CDS       T03009                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb03030  DNA replication
rlb03410  Base excision repair
rlb03420  Nucleotide excision repair
rlb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    RLEG3_15010
   03410 Base excision repair
    RLEG3_15010
   03420 Nucleotide excision repair
    RLEG3_15010
   03430 Mismatch repair
    RLEG3_15010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rlb03032]
    RLEG3_15010
   03400 DNA repair and recombination proteins [BR:rlb03400]
    RLEG3_15010
Enzymes [BR:rlb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RLEG3_15010
    6.5.1.6  DNA ligase (ATP or NAD+)
     RLEG3_15010
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     RLEG3_15010
DNA replication proteins [BR:rlb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    RLEG3_15010
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     RLEG3_15010
DNA repair and recombination proteins [BR:rlb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     RLEG3_15010
   NER (nucleotide excision repair)
    Other NER factors
     RLEG3_15010
   MMR (mismatch exicision repair)
    Other MMR factors
     RLEG3_15010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: AHF83045
UniProt: W0IAA7
LinkDB All DBs
Position
1008421..1010046
Genome map
AA seq 541 aa AA seqDB search
MKAFADLLDRLVLTPSRNGKLKLLTDYFRDTPDPDRGYGLAAIAGTLEVRNVKPAMLREL
VLERMDEVLFRYSYDYVGDLAETISLVWDNERDIDRSALAQPRLGEVVTGMNALGRTEVR
SYVRDLLDRLDSSGRFAFIKLATGAMRIGVSARLAKQALADLGDKDVIEIETLWHGLQPP
YETLFEWLAGGGEKPVLATPAIFHSVMLANAVEEGDLTGLDPVNYAAEWKWDGIRVQLSR
SGDRRKIYSRSGDDISGAFPDILDAINFSGVVDGELLVGGTARSNSPTRTFSDLQQRLNR
KTVTAKMLGDYPAFIRTYDLLFDDDDDVRGRSYVDRRDRLTEIIDRAPHDRFDLSPLVPF
SSWEELDRLRAAPPDPVIEGVMIKRRDSIYQAGRMKGPWFKWKRDPYNVDAVLMYAQRGH
GKRSSYYSDFTFGVWADDEDGEQLVPVGKAYFGFTDAELEVLDKFVRNNTTERFGPVRAV
RADKDFGFVVEVAFEGINRSTRHKSGVAMRFPRIARLRPDKPSYEADRLRTLIAMIDVKP
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgccgatctcctcgaccgcctggtgctgacccccagccgcaacggcaag
ctgaagctgctgaccgactatttccgcgacacgccggatccggaccgcggctacggcctt
gccgctatcgccggcacgctggaggtgcgcaacgtcaagcccgccatgctgcgcgagctg
gtgctggagcgcatggacgaggtgctgtttcgatattcctacgactatgtcggcgatctt
gccgaaaccatctcgctcgtctgggacaatgagcgggatatcgaccgctcggcccttgcc
cagccgcgtctcggcgaggtcgtcaccggcatgaacgcgctcggccgcaccgaagtgcgc
agctacgtccgcgatcttctcgaccggctggattcatccggccgtttcgccttcatcaag
cttgccaccggcgccatgcgcatcggcgtctccgcccgccttgccaagcaggcgctcgcc
gatctcggcgacaaggacgttatcgaaatcgaaaccctctggcatggcctgcagccgccc
tatgagacgctgttcgaatggctggcgggtggcggcgaaaagccggtgctggcgacaccg
gcgatcttccattccgtcatgctcgccaatgcggtggaggagggcgatctgaccggtctc
gatccggtgaattatgccgccgaatggaaatgggacggcatccgcgtccagctctcccgc
tccggcgacaggcgcaagatctattcccgctccggcgacgacatatcaggcgcctttccc
gatattctcgacgcgatcaatttttccggcgtcgtcgacggcgagctgctggtcggcggc
accgcccgctcgaacagcccgacccgcaccttctccgacctgcagcagcgcctgaaccgc
aagacggtgacggcgaagatgctcggcgactatcccgccttcatccgcacctatgacctg
ctcttcgacgacgacgatgatgtccgcggccgcagctatgtcgatcgccgcgaccggctg
accgagatcatcgaccgcgccccccacgaccgtttcgatctctcgccgctcgtgcccttc
tcgtcgtgggaagagctcgatcgtctccgcgccgccccgcccgatccggtcatcgaaggc
gtgatgatcaagcgccgcgacagcatctaccaggccggccgcatgaagggcccctggttc
aagtggaagcgcgacccctataatgtcgatgcggtgctgatgtatgcccagcgcggccac
ggtaaacgctccagctactattccgatttcaccttcggcgtctgggccgatgacgaggac
ggcgaacagctggtgcccgtcggcaaggcctatttcggcttcaccgatgccgaactcgag
gtgctcgacaaattcgtgcgcaacaataccaccgagcgtttcggcccggtgcgcgccgtg
cgcgccgacaaggatttcggcttcgtcgtcgaagtggccttcgaaggcatcaaccgctcg
acccggcacaaatcgggggtcgccatgcgcttccctcgcatcgcccgccttcgccccgac
aagccctcctacgaggccgaccggctgcgcacgctgatcgctatgatcgacgtcaagccc
gagtga

DBGET integrated database retrieval system