KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_24820Help
Entry
RLEG3_24820       CDS       T03009                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00473  D-Alanine metabolism
rlb00550  Peptidoglycan biosynthesis
rlb01100  Metabolic pathways
rlb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RLEG3_24820
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RLEG3_24820
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RLEG3_24820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rlb01011]
    RLEG3_24820
Enzymes [BR:rlb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RLEG3_24820
Peptidoglycan biosynthesis and degradation proteins [BR:rlb01011]
 Precursor biosynthesis
  Amino acid ligase
   RLEG3_24820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp ATP-grasp_3 GARS_A Arg_repressor CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AHF84837
UniProt: W0IK44
LinkDB All DBs
Position
complement(2883175..2884101)
Genome map
AA seq 308 aa AA seqDB search
MSRKHVAVLMGGFSSERPVSLSSGKACAEALEAEGFDVTRIDVARDVSEKLAALKPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKDKAKLVAAAAGIPVAESQVVNR
FAFPSTHPMKPPYVVKPLREGSSFGVVIVTEDQAHPPQIVSSPEWRYGEEVIVERYVYGR
ELTCGVMGETPLGVTEVVPQGHNFYDYDSKYAAGGSKHVIPAKISPNIYQKIQTLSLRAH
QAIGCRGVSRSDFRYDDRFSEDGEIIWLEVNTQPGMTPTSLVPEMAGHAGYSFGQFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaagcatgtcgctgtcctgatgggcggattttcctcggaaaggcctgtcagc
ctttcctcgggaaaggcttgcgcagaagccctcgaggcggagggattcgacgtgacgcgc
atcgacgtggcgcgcgacgtttccgagaaactcgccgcgctgaagcccgatgtcgtcttc
aatgcgcttcacggcccgttcggcgaggacggcaccattcagggcatcctcgaatatctc
gaaatcccctatacgcattcgggcgtgcttgcctcggcgctggcgatggacaaggacaag
gcgaagctcgttgccgccgccgccggcattcctgttgccgaatcgcaggtggtcaaccgt
ttcgcctttccctcgacgcatccgatgaagccgccctatgtggtgaaacccctccgcgag
gggtcgagcttcggcgtcgtcatcgtcacggaagatcaggcgcatccgccgcagatcgtc
agctcgcccgagtggcgttacggcgaggaagtgatcgtcgagcgctatgtttacggacgc
gaactcacctgcggtgtcatgggtgaaactccgctcggtgtcacggaagtggtgccgcag
ggacacaatttttatgattacgactccaaatatgcggcgggcggttcaaaacacgtcatc
ccggcgaaaatttcaccgaatatttaccaaaaaatacaaacattgtccctaagggcgcat
caggcaatcggttgtcgcggcgtcagtcggtccgactttcgttacgacgatcgtttttcc
gaagacggcgaaatcatctggctggaggtcaatacccagccagggatgactccaacctcg
ctcgtgcccgaaatggccggccatgccggctattcctttggtcagtttctccggtggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system