KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_30040Help
Entry
RLEG3_30040       CDS       T03009                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00010  Glycolysis / Gluconeogenesis
rlb00620  Pyruvate metabolism
rlb01100  Metabolic pathways
rlb01110  Biosynthesis of secondary metabolites
rlb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RLEG3_30040
   00620 Pyruvate metabolism
    RLEG3_30040
Enzymes [BR:rlb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RLEG3_30040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AHF85804
UniProt: W0IMR1
LinkDB All DBs
Position
3966111..3967619
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVESPFKLKYGNYIGGEWREPVEGKYFENLTPVTGGKLCDIPRSNEKDINLALDA
AHAAKEKWGRTSAAERSNILMKIAQRMEDKLELLAQAETWDNGKPIRETMAADIPLAIDH
FRYFASCIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALAAGNC
VVLKPAEQTPASILLWAELVGDLLPPGVLNIVNGFGLEAGKPLATSQRVAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMEKAVKRVEAIKQGNPLDTATMIGAQASTEQLEKILAYLDIGKQEGA
EVLTGGSRNDLGGELANGYYVKPTIFKGHNKMRVFQEEIFGPVVSVTTFKNEKEALEIAN
DTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatcagaaaatcgtcgagtcgccgttcaagctgaaatacggcaactatatcggc
ggcgaatggcgcgagccggtcgagggaaaatacttcgaaaacctgacgcccgtcaccggc
ggcaaactctgcgacattccccgctccaatgaaaaggacatcaatctcgcgctcgacgcc
gcccatgcggcgaaggaaaaatggggccgcacttccgctgccgagcgctccaatatcctc
atgaagatcgcccagcgcatggaagacaagctggaattgctcgctcaggccgagacctgg
gacaacggcaagccgatccgcgaaaccatggcggccgacattccgctggcgatcgaccac
ttccgctacttcgcctcctgcattcgtgcccaggaaggttcgatcggcgagatcgaccac
gataccgtggcctatcacttccatgagccgctcggcgtcgtcggccagatcattccgtgg
aacttcccgatcctgatggccacctggaagctggcacctgcgcttgccgccggcaactgc
gtcgtgctgaagcccgccgagcagacaccggcctcgatcctgctctgggccgaactcgtc
ggcgatctcctgccacccggcgtgctcaacatcgtcaacggtttcggcctcgaagccggc
aagccgctggcgaccagccagcgcgtcgccaagatcgccttcaccggcgagacgacgaca
ggccggttgatcatgcaatatgccagccagaatctcattccggtgacgctggagctcggc
ggcaaatcgccgaacatcttcttcgccgatgtgatggccgaagacgacgacttcctcgac
aaggcgctcgaaggctttgcgatgtttgccctcaaccagggcgaagtctgcacctgcccg
agccgcgccctcgtccaggaatcgatctacgaccgcttcatggaaaaggccgtcaaacgc
gtcgaagcgatcaagcagggcaacccgctcgacaccgcgacgatgatcggcgcccaggcc
tcgacggagcagctggaaaagatcctcgcctatctcgatatcggcaagcaggaaggcgcg
gaagtgctgaccggcggctcgcgcaacgatctcggcggcgagttggcgaatggctattat
gtcaagccgacgatcttcaagggtcacaacaagatgcgtgtgttccaggaggagatcttc
ggaccggtggtttcggtcacgaccttcaagaacgagaaggaagcgctcgaaatcgccaac
gacacgctctacggtctcggcgccggtgtctggagccgcgacgccaatcgctgctaccgc
ttcggccgcgagattcaggccggccgcgtctggaccaactgctaccacgcttacccggcg
catgccgccttcggcggctacaagcagtcgggcatcggccgcgaaacccacaagatgatg
ctcgaccactaccagcagaccaagaacatgctggtgagctacagcccgaaggcactcggc
ttcttctga

DBGET integrated database retrieval system