KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_32785Help
Entry
RLEG3_32785       CDS       T03009                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00250  Alanine, aspartate and glutamate metabolism
rlb00410  beta-Alanine metabolism
rlb00640  Propanoate metabolism
rlb00650  Butanoate metabolism
rlb01100  Metabolic pathways
rlb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RLEG3_32785
   00650 Butanoate metabolism
    RLEG3_32785
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RLEG3_32785
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RLEG3_32785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rlb01007]
    RLEG3_32785
Enzymes [BR:rlb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RLEG3_32785
Amino acid related enzymes [BR:rlb01007]
 Aminotransferase (transaminase)
  Class III
   RLEG3_32785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHF86313
UniProt: W0IJK8
LinkDB All DBs
Position
complement(4551766..4553046)
Genome map
AA seq 426 aa AA seqDB search
MTAISLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPR
VIAAVKDQLDRFTHTCHQVVPYESYVHLAERLNALLPGDFEKKTIFVTTGAEAVENAVKI
ARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHIPFPVELHGVTAD
QSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYSAPAAFMKALRELCDQHGILLIADEV
QTGFARTGRMFAMDHHEVAPDLTTMAKSLAGGFPLAAVTGRAAIMDAPGPGGLGGTYGGN
PLGIAAAHAVLDVIVDEDLCNRANLLGGRLKQRLESLRETVPEIVDIRGPGFMNAVEFND
RTTGLPSAEFANRVRLIALDKGLILLTCGVHGNVIRFLAPITIQDEIFGEALDILEASML
QASAAK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgataagccttaccgaccggaagaacgccgctatttcacgcggcgtcggcatg
acgacccagatctatgcggatcgcgcagagaatgccgagatttgggacaaggagggccgc
cgctacatcgatttcgccgccggcatcgccgttctcaataccggccatcgccatccccgg
gtcatcgcagcggtcaaggatcagctcgaccgcttcacccatacctgccatcaggtggtg
ccctacgaaagctacgtccaccttgccgaacggctgaacgcgctgctgcctggtgatttc
gagaagaagacgatcttcgtcacgacgggcgccgaagcggtcgagaacgccgtcaagatc
gcgcgcgccgcaaccggccgctcggccgtcatcgcctttggcggcggcttccatggccgc
accttcatgggcatggcgctgaccggcaaggtcgtgccctacaaggtcggcttcggcgcg
atgcccggcgacgtgttccatattcccttcccggtcgagctgcacggcgtcaccgccgat
cagtcgctggcggcactgaagaagctcttcgccgccgatgtcgatccgcagcgcgtcgcg
gccatcatcatcgagccggtacagggcgaaggcggcttctactccgcacctgctgccttc
atgaaggcgctgcgcgagctctgcgaccagcacggcatcctgctgatcgccgacgaggtg
cagaccggttttgcacgcaccggcaggatgttcgcaatggatcatcacgaggtggcgccc
gacctgacgacgatggcaaagagcctggccggcggctttccgctcgccgccgtcaccggc
cgcgccgcgatcatggatgcgccgggaccgggcgggctcggcggcacctatggcggcaat
ccgcttgggatcgccgctgcccatgccgtgctcgacgtcattgtcgacgaggatctctgc
aaccgcgccaacctgctcggcggacggctgaagcagcggctggaatcattgcgcgagacg
gtgccggagatcgtcgatatccgcgggccgggcttcatgaacgccgtcgaattcaacgac
cggacgacgggactgccgagcgcggaattcgccaaccgggtgcggctgatcgcgctcgac
aagggcctgatcctgctcacctgcggcgtccacggaaacgtcatccgcttcctcgcgccg
atcaccatccaggacgagatcttcggcgaagcgctcgatattctcgaggcctccatgctg
caagcaagcgcggccaagtga

DBGET integrated database retrieval system