KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0102Help
Entry
RL0102            CDS       T00402                                 

Gene name
goaG
Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00250  Alanine, aspartate and glutamate metabolism
rle00410  beta-Alanine metabolism
rle00640  Propanoate metabolism
rle00650  Butanoate metabolism
rle01100  Metabolic pathways
rle01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RL0102 (goaG)
   00650 Butanoate metabolism
    RL0102 (goaG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RL0102 (goaG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RL0102 (goaG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rle01007]
    RL0102 (goaG)
Enzymes [BR:rle01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RL0102 (goaG)
Amino acid related enzymes [BR:rle01007]
 Aminotransferase (transaminase)
  Class III
   RL0102 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAK05590
GeneDB: RL0102
RhizoBase: RL0102
UniProt: Q1MN62
LinkDB All DBs
Position
complement(130039..131319)
Genome map
AA seq 426 aa AA seqDB search
MNATSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPR
VIAAVKDQLDRFTHTCHQVVPYESYVHLAERLNALLPGDFEKKTIFVTTGAEAVENAVKI
ARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHIPFPVELHGVTAD
QSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYSAPAAFMKALRELCDQHGILLIADEV
QTGFARTGRMFAMDHHEVAPDLTTMAKSLAGGFPLAAVTGRAAIMDAPGPGGLGGTYGGN
PLGIAAAHAVLDVIVDEDLCNRANLLGGRLKQRLESMRETVPEIVDIRGPGFMNAVEFND
RTTGLPSAEFANRVRLIALDKGLILLTCGVHGNVIRFLAPITIQDEIFGEALDILEASML
QASAAK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgacaagccttacggaccggaagaacgccgccatttcccgcggcgtcggcatg
acaacccagatttatgcggatcgtgcagagaatgccgagatctgggacaaggagggccgc
cgttacatcgatttcgccgccggcatcgccgttctcaataccggccaccgccatccccgg
gtcatcgcagcggtcaaggatcagctcgaccgattcacccatacctgccatcaggtggtg
ccctatgaaagctacgtacaccttgccgaacgactgaacgcgctgcttcctggtgatttc
gagaagaagacgatcttcgtcacgacgggtgccgaagcggtcgagaacgccgtcaagatc
gcgcgcgccgcaaccggccgctcggccgtcatcgcctttggcggcgggttccatggccgc
accttcatgggcatggcgctgaccggcaaggtcgtgccctacaaggtcggcttcggtgcg
atgcccggcgacgtgttccatattcccttcccggtcgagctgcacggcgtcaccgccgat
cagtcgctggcagcactgaagaagctcttcgccgccgatgtcgatccgcagcgcgtcgcg
gccatcatcatcgagccggtacagggcgaaggcggcttctactccgcacctgctgccttc
atgaaggcgctgcgcgagctctgcgaccagcacggcatcctgctgatcgccgacgaggtg
cagaccggttttgcccgcaccggcagaatgttcgcgatggatcatcacgaggtggcgccc
gacctgacgacgatggcaaagagcctggccggcggctttccgctcgccgccgtcaccggc
cgcgccgcgatcatggatgcgccgggacctggcgggctcggcggcacctatggcggcaat
ccgcttgggatcgccgctgcccatgccgtgctcgacgtcattgtggacgaggatctctgc
aaccgcgccaacctgctcggcggacggctgaagcagcggctggaatcaatgcgcgagacg
gtgccggagatcgtcgatatccgcgggccgggcttcatgaacgccgtcgaattcaacgac
cggacgacgggactgccaagtgcggaattcgccaaccgggtgcggctgatcgcactcgac
aagggcctgatcctgctcacctgcggcgtccacggaaacgtcatccgcttcctcgcgcca
atcaccatccaggacgagatcttcggcgaagcgctcgatattctagaggcctccatgctg
caagcaagcgcggccaagtga

DBGET integrated database retrieval system