KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0116Help
Entry
RL0116            CDS       T00402                                 

Gene name
fabA
Definition
(GenBank) putative 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (Beta-hydroxydecanoyl thioester dehydrase)
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00061  Fatty acid biosynthesis
rle01100  Metabolic pathways
rle01212  Fatty acid metabolism
Module
rle_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RL0116 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rle01004]
    RL0116 (fabA)
Enzymes [BR:rle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     RL0116 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     RL0116 (fabA)
Lipid biosynthesis proteins [BR:rle01004]
 Fatty acid synthase
  Component type
   RL0116 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: CAK05604
GeneDB: RL0116
RhizoBase: RL0116
UniProt: Q1MN48
LinkDB All DBs
Position
144197..144712
Genome map
AA seq 171 aa AA seqDB search
MTTRQSSFSYEELIACAHGELFGPGNAQLPLPPMLMVHRITEISETGGTFDKGYLRAEYD
VRPDDWYFPCHFEGNPIMPGCLGLDGMWQLTGFFLGWLGEEGRGMALSTGEVKFKGMVRP
QTKLIEYGIDFKRVMRGRLVLGTADGWLKADGETIYQAADLRVGLSKDKTA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagacagtccagcttctcgtatgaagaactcatcgcttgcgcacatggcgag
ctgttcgggcccggcaatgcacagctgcctctgccgcccatgctgatggttcaccgcatc
acggagatttccgaaacgggcggcaccttcgataagggctacctcagggcggaatatgac
gttcgcccggatgactggtattttccctgccatttcgaaggcaacccgatcatgccgggt
tgcctcggtctcgacggcatgtggcagctgaccggtttctttctgggttggctcggcgaa
gaaggccgcggcatggcgctttcaacaggcgaagtgaaattcaagggcatggtccggcca
cagacgaagctgatcgaatatggcatcgacttcaagcgtgtcatgcgcggccgtctggtc
ctcggcaccgccgacggctggctaaaggcggacggcgagaccatatatcaggcggccgat
cttcgcgtcggtctatcgaaagacaagacggcctga

DBGET integrated database retrieval system