KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1757Help
Entry
RL1757            CDS       T00402                                 

Gene name
tufB1
Definition
(GenBank) putative elongation factor Tu (Ef-Tu)
  KO
K02358  elongation factor Tu
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rle03012]
    RL1757 (tufB1)
   03029 Mitochondrial biogenesis [BR:rle03029]
    RL1757 (tufB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rle04147]
    RL1757 (tufB1)
Translation factors [BR:rle03012]
 Eukaryotic Type
  Elongation factors
   RL1757 (tufB1)
 Prokaryotic Type
   RL1757 (tufB1)
Mitochondrial biogenesis [BR:rle03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RL1757 (tufB1)
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RL1757 (tufB1)
  Exosomal proteins of breast cancer cells
   RL1757 (tufB1)
  Exosomal proteins of colorectal cancer cells
   RL1757 (tufB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAK07252
GeneDB: RL1757
RhizoBase: RL1757
UniProt: Q1MIE3
LinkDB All DBs
Position
1856153..1857328
Genome map
AA seq 391 aa AA seqDB search
MGKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPINLPFLLPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRPTTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVTRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVSVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagagtaagtttgagcgcaacaagccgcacgtcaacattggcacgattggccac
gttgaccacggtaagacgtctctgacggcagcgatcacgaagtacttcggtgagtacaag
gcgtacgaccagatcgacgcggctccggaagaaaaggcgcgtggcatcacgatttcgacg
gcccacgttgaatatgagacgccggcccgccactacgcccacgttgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgctgcccagatggacggcgcgatccttgtg
tgctcggccgctgacggcccgatgccgcagacgcgcgaacacattctgctggctcgccag
gttggcgttccggcaatcgtggtgttcctgaacaaggtcgaccaggtcgacgacgccgag
cttctcgaactggtcgagctcgaagttcgcgaactgctgtcgtcctacgacttcccgggc
gacgatattccgatcatcaagggttccgcacttgctgcccttgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggttgacgcctacatcccgacgcct
gagcgtccgatcaacctgccgttcctgctgccgatcgaagacgtgttctcgatctcgggc
cgcggcacggttgtgaccggccgcgtcgagcgtggcattgtcaaggttggcgaagaagtc
gagatcgtcggcatccgcccgacgacgaagacgacggtgaccggcgttgaaatgttccgc
aagctgctcgatcagggccaggctggcgacaacatcggcgcgctgatccgcggcgtcacc
cgtgacggcgttgagcgtggccagattctgtgcaagccgggttcggtcaagccgcacaag
aagttcatggcagaagcctacatcctgacgaaggaagagggtggtcgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgaccgacgtgacgggcatcgtgacg
ctgccggaaggcacggagatggtcatgccgggcgacaacgtcacggtatcggtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgcgatccgcgaaggcggccgcacc
gtcggcgccggtatcgtcgcgtcgatcgtcgagtaa

DBGET integrated database retrieval system