KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2633Help
Entry
RL2633            CDS       T00402                                 

Gene name
gstA6
Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RL2633 (gstA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rle02000]
    RL2633 (gstA6)
Enzymes [BR:rle01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RL2633 (gstA6)
Transporters [BR:rle02000]
 Other Transporters
  Pores ion channels [TC:1]
   RL2633 (gstA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 GST_C_2 Tom37 GST_C
Motif
Other DBs
NCBI-ProteinID: CAK08121
GeneDB: RL2633
RhizoBase: RL2633
UniProt: Q1MG02
LinkDB All DBs
Position
2773071..2773697
Genome map
AA seq 208 aa AA seqDB search
MTEELVFYTNPMSRGRIARWMLEEIGQPYRTELLTFGETMKAPEYLAVNPMGKVPAIRHG
DTIVTECAAICAYLAETFPEKALAPKQEERARYYRWMFFAAGPLESAVTMKALGFEIPKE
RLRMAGCGGFGDVMNTLEKAVSASTYITGERFTAADVYVGSHIGWGIGFGGIERRQAFLD
YVGRISQREAYKRANALDDEAIKTMQAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaattggtattctatacgaacccgatgtcgcgcggccgcatcgcgcgctgg
atgctggaggagatcggccagccttaccgcaccgaactcctgaccttcggcgaaaccatg
aaggcgccggaatatctcgcggtcaatccgatgggcaaggtgccggcaatccgccacggc
gacaccatcgtcaccgaatgcgcggcgatctgcgcctatctagccgagaccttccccgaa
aaggccctggcgccgaagcaggaggagcgcgcccgctattaccgctggatgttctttgcc
gccggcccgctcgaatcggcggtgacgatgaaggctctcggcttcgaaattccgaaagag
cggctgcgcatggccgggtgcggcggtttcggcgacgtcatgaacacactcgagaaagcc
gtctccgcttcgacctacatcaccggcgagcgtttcaccgccgccgacgtctatgtcggc
tcccatatcggctggggcatcggattcggcggcatcgaaagacgccaggccttcctcgac
tatgtcggccgcatcagccagcgtgaggcctacaagcgggccaacgcccttgatgacgaa
gccatcaagacaatgcaggccgcctga

DBGET integrated database retrieval system