KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2654Help
Entry
RL2654            CDS       T00402                                 

Definition
(GenBank) putative transmembrane protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Apolipoprotein ApoLp-III Baculo_PEP_C NPBW
Motif
Other DBs
NCBI-ProteinID: CAK08142
GeneDB: RL2654
RhizoBase: RL2654
UniProt: Q1MFY1
LinkDB All DBs
Position
2795751..2802878
Genome map
AA seq 2375 aa AA seqDB search
MANNKYNESIEDKAFKALDEALQIDFSKDNVPSRRGDAPQAPEANVSDPVNARNQQAQEE
AQRRSRRGAAGEQASRGPAFAPANDASRNTPASILKSFDGASSRSAVRTATLFSVLWVMA
GLGLMSLLYAPQIWQIRSLADLVALPGVIAGLVGIIIPVMMFYAFAIMISRAQDMRNAAR
SMAEVALRLAEPETIASERIMTVGQAVRREVSAMNEGIERTIARASELETLVHSEVNALE
RSYADNELRVRGLVHELGSEREAIVNHADRIRTSIGSVHDQLKEELSLATEEIAVRLATS
GEAFASLIDTRAATILEKSDSALQSMGSLLAAKTDTLLQTLNASGFALATEFDNRLEALS
VNLNDHGERLLSQFETRASTMDSSTEKLNAALNERTHQLNEILIARTREINESLTSGERT
IGGTLDDVLSKLNNALDEKGASFRQSLQTTADDAVMDLDVRSGFFEERLQTTVAQLSTAF
DERVSEFTSAFDKRTGSLDTKLMESLARINETLTGGSDSIDGILNSGIDRLGSSMTDQSL
ALATALATGHEVLESTLGNRADEITTALTSRTGELTSALQSATSEIALTLATGTSELQNN
LQTRSAEFRDTLRTTTTDLTTAVAAGTEQVTTAFGGRAEELSGVLAARAAEISEALGTAH
GRIDSVMAERGGALVEALTTHHGRFEEALTTRSDAIINAVSDTHDRLAETLDEKSMALAI
SLNESQARIEDTLETRSEAFLNAVSGTHHRLSETLDEKAMALAISLSENQARIEDTLETR
SEAFLNAVSGTHDRLSETLDSKAAALTTSLDERHARIEDALGTRAEALLNTVSGTRDRLA
ETLDEKAMALAMSLNESHARIEETLETRSAALLNAVSGTHDRLSETLDGKAAAFATSLSE
GQARIENTLESRSAALLNAASGIHDRLSETLDEKAMALAISLNETQTRIEDTLETRSAAL
LNAVSGTHDRLSETLDEKAMTLAISLNESQSRIEDTLEARSEAFLKAVSGTHDRLSETLD
EKATAIAASLNEGQSRLQDTLESRSESFLNAVSATHDRLSETLDDRAMALAISLNESQSR
LEETLTTGADAITNAVSGTHVGLNGVLDQKAAALATSLSEGQARLEEALGHRTAAIIGAV
TATHDRLTDTLDEKTMALAISLDDNQSRFDSVLEARSNAIMEAVSGAEARVAGAFSDKTD
AIRTAYTDNQQRLENALSEHSAALSGVLDAGGNRFEDLVGGLTGRIEGRLTDAHTRLGGL
ADEAAARIEGGLASAHERIRTTLEDRANAIDLSLNQAHALISDTLAEQATSIGTSVATSV
GMLELSLEHREAAIRQAIDAGAQTLEDRMHAGAGQIAGRFQEAANAISSSTQDFSAHLDR
SVESLTGRFEETGARVEAGLAAIETRIRDGVGGVAERVEAASGQLSGVLADGVSRIGALS
DDATQRISATLEGSAANLTQAIDNRTANLAETLDSRTTSLTDAIDGRTASLGETLDRGNE
RIEERLSTMDRALTVGLEAVNRTIEGKAAGLASTLRSAVADAAQGMEGEATRTTELLGKT
GQQFAEDLNTKSDEFTRTMDERSSQIVTRVAEAQNRLASQAAAVAQTFSEAGNAIVNKVA
EAETIVGTQVNAISKVLSDAGQSLETRGNAIRSTLSGAGSEISATMADVDRALEARSSAI
RTNLEERAREIDTTFSDIDRALEARGNSIRSTLEERTRDLNSMLSGRSVELTRILDETAR
PIIDRYTDAGEQAAARITAAANLSADRLRAENEALASAVAARTENVANAVSAIENSLVGN
VNGLVERMSESSAAMAMMMNRAAEQLASVDGRLGDTTTRFADSATKAAEMVSASTRLLEG
KVDRLSDISGQTLAQVGGIIGRFDEHSKVLTQASQLLGAAQSNLASTLEERESALQTLSV
GLVQRSAEIEKTMQGLGGMIETVFERAEQRSAQVTGNLRQGVQSSFADIGRILTETEKRA
QEAAETMREAITRAGDEANTTIDGTFANVERRSGDLSNRIRGGLTASLSEVERMLGEAGR
ASDGAAQNMREALREAIDDAVGRFSGATEDIRRSAADIRSELDATRAELKRGAFDLPEEA
KESASAMRRAVAEQIKALQDISQLVGRSSQQLEISEPVARTLAQVQPAPRPSKPVAAQPP
QAAAPPPIEATGLRGTIAPSAPAAAPQRAAPQPAPARQETGRPETGRQEPARPESGGWIS
DLLRGASREEAADEAAAARVPARPAETAAPAARSNDSRNPRHVVESLNSLSVDIARAIDH
DASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFRTAVDRYIGDFEKLLA
DVARTDPNRTVTQSYLTSDTGKVYTMLAHAAGRLG
NT seq 7128 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaacaaatataacgagtcaattgaggacaaggcgttcaaggcattggacgag
gcgctccagatcgactttagcaaggataacgtaccgtctcgccgcggcgacgcgccccag
gccccggaggctaatgtgtctgatccagtaaatgcgcgtaaccagcaggcccaggaagaa
gcgcagcgccgcagccgccgcggtgccgccggcgagcaggcttccaggggtccggccttc
gcgcccgccaacgatgccagccgcaatacgcccgcctcgatcctgaaatcctttgacggc
gcctccagccgctcggcggtgcgcaccgccaccctgttttccgtgctttgggttatggcc
ggccttggcctgatgtcgctgctttatgctccgcagatctggcagatccgttcgctcgcc
gatctcgtcgccctgcccggcgtgatcgccggcctcgtcggcatcatcattcccgtgatg
atgttctatgccttcgccatcatgatctcccgcgcccaggacatgcgcaacgccgcccgc
tccatggcagaggtggcgttgcgcctggcagagccggaaaccatcgcctccgagcgcatc
atgaccgtcggccaggccgtgcgccgtgaggtctcggccatgaatgaaggcatcgagcgc
accatcgcgcgtgcctccgagctggaaacgctcgtccattccgaagtcaatgcgcttgaa
cgttcttatgcggacaacgagttgcgcgttcgcggcctcgtccacgaactcggctccgaa
cgcgaggcgatcgtcaaccatgccgaccgtatccgcacctcgatcggcagcgtgcacgac
cagttgaaggaagagctgtcgcttgcgaccgaagagatcgcggtgcggctggccacatcg
ggcgaagccttcgcctcgctgatcgatacacgcgccgcaacgatcctggaaaaatcggac
agcgccttgcagtcgatgggcagcctgctcgccgccaagaccgataccctgctgcagacc
ctaaacgcatcgggttttgcgctggccaccgaattcgacaaccgcctcgaagccctctcc
gtcaatctcaacgatcatggcgaaaggctgctcagccagttcgagacgcgcgcctcgacc
atggacagcagcaccgaaaagctgaatgcggcgctgaacgagcgtacgcaccagctcaac
gagatcctgatcgcccgcacccgcgagatcaatgagagcctgacgtcaggcgaacgcacc
atcggcggcacgctcgacgacgtgctatcgaagctgaacaacgcgctcgacgaaaagggc
gcaagcttccgccagagcctgcagaccaccgccgacgacgccgtcatggatctcgacgtg
cgctccggcttcttcgaggagcggctgcagacgaccgtcgcccagctgtcgaccgccttc
gacgaacgcgtctccgaattcaccagcgccttcgacaaacgcaccggctcgctcgacacc
aagctgatggagagcctcgcccgtatcaacgagacgctgaccggcggatcggattcgatc
gacggcatcctgaattccggcatcgaccgccttggttcgtcgatgaccgaccagtcgctg
gcgctcgccaccgcgctcgccaccggccacgaagtgctggaaagcacgctcggtaaccgg
gcggacgaaatcaccaccgcactcaccagccgcactggcgagctgacctcggcgctgcag
agcgcgacctcggaaatcgcgctgacgcttgcgaccggcacctccgagctgcagaacaac
cttcagacacgctcggccgaattccgcgacacgctgcgcaccaccaccaccgatctgacg
actgccgttgccgctggcaccgagcaggtgaccacggccttcggcggtcgcgccgaggaa
ctgagcggcgtgcttgccgcccgtgcggccgaaatcagcgaggcgctcggcacggcccat
ggccgtatcgacagcgtcatggcagagcgcggcggcgcactggtcgaggcgctgaccacc
catcacggccgcttcgaggaagcgctgacgacccgctccgacgccatcatcaatgccgtc
tccgacacccatgaccgtcttgccgagacgctcgacgaaaagtcgatggcgctcgccatc
tctctgaacgagagccaggcccgcatcgaggacacgctcgagacccgctccgaggccttc
ctcaacgccgtgtctggcacccatcatcgcctctccgagacgctcgacgagaaggcgatg
gcgctcgccatttcgctcagcgaaaaccaggcccgcatcgaggatacgctcgagacccgc
tccgaggccttcctcaacgccgtgtctggcacgcatgatcgcctgtcggaaacgctggac
agcaaggcggcggccctgacgacctcgctcgacgagcgccatgcccgcatcgaggatgcg
cttggaacgcgcgccgaggcactgctgaacactgtatccggcacgcgcgatcgtcttgcc
gagacgctcgacgagaaggcgatggcgctcgccatgtccttgaacgagagccatgcccgt
atcgaggagacgctggaaacccgctccgccgccctgctgaacgctgtctccggcacccat
gatcgtctctcggagactctggacggcaaggcggcagcttttgccacctcgctgagcgaa
ggccaggcccgtatcgagaatacgctcgaaagccgctccgcagcgctgctgaacgccgcc
tccggcatccatgatcgcctctccgagacgctggacgaaaaggcgatggcactcgccatt
tcgctcaacgaaacccagacgcgtatcgaggacacgctggaaacccgttcggcggccctg
ctgaatgcggtctccggcacgcatgatcgcctctccgagacgctggacgagaaggcgatg
acgctcgccatctcgctcaatgagagccagtcgcggatcgaagacacgctggaagcacgc
tccgaagccttcctcaaggccgtgtccggtacgcacgaccgtctctcggaaacgctcgac
gaaaaggcgacggcgatcgccgcctccctgaacgagggccagagccgcctgcaggacacg
ctggagagccgctcggaatccttcctgaatgcggtctctgccacccacgaccgcctgtcc
gagacactcgacgatcgggcgatggcgcttgccatctcgctgaacgagagccagagccgt
ctcgaggagacgctgacaacaggcgccgatgcgatcaccaatgcggtctccggcacgcat
gtcggcctgaacggtgtactcgaccagaaggccgccgccctcgccacctcgctgagcgaa
ggccaggcccgcctcgaggaagccttgggccaccgcaccgccgcgatcatcggcgccgta
acggcaacccacgatcggctcaccgatacgctcgacgaaaagaccatggcgctcgccatt
tcgctcgatgataaccagagccgcttcgacagtgtgctcgaagcccgcagcaacgccatc
atggaggccgtctccggtgccgaggcacgagtcgccggcgccttctccgacaagaccgat
gcgatccgcactgcctataccgataatcaacagcggctcgaaaatgcgctttctgaacat
agcgccgccctctcgggcgttctcgatgctggcggcaaccgctttgaggatctcgtcggc
ggcttgaccggccgcatcgaaggccgtctgaccgatgcccatacacggctcggaggcctc
gccgacgaagccgcggctcgtatcgagggcgggctcgcctctgcccatgagcgcatccgt
acgacgctcgaagaccgcgccaacgccatcgacctatcgctgaaccaggcccatgcgctg
atcagcgatacgctggccgaacaggcgaccagcatcggcacctcggtggcgacgagcgtc
ggcatgctcgaattgtcgctggagcaccgtgaagccgcgatccgccaggcgatcgatgcc
ggcgcccagacattggaagatcgcatgcatgccggcgcgggccaaatcgccggccgcttc
caggaggcggcaaatgcgatttcgagctccacccaggatttctccgcccacctcgatcgg
tcggtcgaaagcctgacgggccgttttgaagaaaccggggcgcgtgtggaagccggcctt
gcggcgatcgagacccgcatccgcgacggcgtcggcggcgttgccgaaagggtcgaagcg
gccagcggccagctgtcgggcgtgcttgccgacggcgtctctcgtatcggcgcgctcagc
gacgacgccacgcagcgcatctcggcgacgctcgaaggcagtgccgcaaacctcacccag
gcgatcgacaaccgcactgccaatctggccgagacgctggacagccgcacgaccagcctg
accgacgctatcgacggccgcaccgcgagcctcggcgaaactctcgaccgcggcaatgaa
cgcatcgaggaacgcctctccaccatggaccgtgcgttgaccgtcggcctcgaggccgtc
aaccgcaccatcgaaggcaaggccgccggtctcgcctcgacgctgcgcagcgcggttgcc
gacgcagcccagggaatggaaggcgaagccacgagaaccaccgaactgcttggcaagacc
ggccagcaattcgccgaggatctcaatacgaaaagcgacgaattcacccgcacaatggat
gagcgctcgtcgcagatcgtaacccgcgtcgccgaagcgcagaaccggctggcaagccag
gccgctgccgtcgcccagacattctcggaagccggcaacgccatcgtcaacaaggtcgcc
gaagccgagaccatcgtcggcacgcaggtcaatgccatctccaaggtgctgtcggatgcc
ggccagtctctggagacacgcggcaacgccatccgctcgacactgtcgggcgccggcagc
gagatttccgccaccatggcggatgtcgaccgggcgctcgaagcacgcagcagcgccatt
cgcaccaacctcgaagagcgtgcccgcgagatcgatacgacgttctccgatatcgaccgg
gcgctcgaagcacgcggcaactcgatccgctcgacgctcgaggagcgcacgcgcgacctc
aactcgatgctatcaggccgttcggtcgaattgacgcgcatcctcgacgaaacggcccgc
ccgatcatcgaccgctacaccgatgccggcgagcaggccgccgcccgcattaccgccgcg
gccaacctcagcgccgaccgcctgcgcgccgaaaacgaagcgctcgccagcgccgttgcc
gcccgcaccgagaatgtcgccaatgccgtcagcgccatagagaacagcctggtcggcaac
gtcaacggcctcgtcgagcgcatgtcggaaagcagtgctgcaatggcgatgatgatgaac
cgcgccgccgagcaactggccagcgtcgacggccgtctcggcgataccaccacacgcttt
gccgactccgccaccaaggccgctgaaatggtctccgcctcgaccaggcttctcgaaggc
aaggtcgaccgcctctccgacatctcgggccagacgctggcacaggtcggcggcatcatc
ggtcgcttcgacgaacactccaaggttctgacccaggcttcgcagcttctcggcgccgcc
cagtccaacctcgcctcgacgctcgaagagcgcgagagcgctctgcagacgctctcggtc
ggcctcgtccagcgctccgccgagatcgaaaagaccatgcaaggcctcggcggcatgatc
gagaccgtgttcgagcgggcagagcagcgctcagcccaagtcaccggcaatctgcgccaa
ggcgtgcagtcgtccttcgccgatatcggccgcattctcaccgaaaccgagaagcgcgcc
caggaagcggcagagacgatgcgcgaggcgatcacccgcgccggcgacgaggccaatacg
acgatcgacggcaccttcgccaatgtcgagcgccgctccggcgatctctccaatcgcatt
cgcggcggtctcaccgcctcgctgtcggaagtcgagcgcatgctcggcgaagccggccgc
gcttccgacggcgccgcccagaatatgcgcgaagcgctgcgcgaggcgatcgatgatgcc
gtcggccgcttctccggcgccaccgaagatatccgccgctccgccgccgacatccgcagc
gagctcgacgccacccgcgccgaactgaagcgcggcgccttcgatcttcccgaggaagcc
aaggaaagcgcctcggccatgcgccgggccgtcgccgagcagattaaggcgctgcaggat
atctcccaactcgtcggccgctccagccaacagctcgagatctccgaacccgttgcccgc
acgctcgcccaggtgcagccggccccgcgtccctccaagccggtcgcagcccagccgccg
caggcggcagcacccccgccgatcgaagcgacaggtctgcgcggaacgatcgcaccatct
gcgccggctgccgccccccagcgcgccgcgccgcagcctgcccccgctcgccaggaaaca
ggccgcccggaaacaggtcgccaggagccggctcgtccggaaagcggcggctggatcagc
gatctcctgcgtggcgcatcgcgtgaggaggccgccgacgaggccgcggccgcccgtgtt
ccggcccgcccggcggaaactgccgcgccggccgcgcgaagcaatgacagccgcaatccg
cgccacgtcgtcgaatcgctgaactcgctctcggtcgatatcgcccgcgccatcgaccac
gacgcttcggtcgatctctggcgccgttaccagcgcggcgagcgcgatgtcttcacccgt
cgcctctacacgctgaagggccagcagaccttcgacgagatcaagcgcaaatatgaccgc
gaaccggagttccgcaccgccgtcgaccgctacatcggtgatttcgaaaagctgctcgcc
gacgtcgcccgcaccgacccgaaccggacggtgacgcagtcctacctcacctcggatacg
ggcaaggtctacacgatgctcgctcatgccgcaggcaggctcggctga

DBGET integrated database retrieval system