KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3301Help
Entry
RL3301            CDS       T00402                                 

Gene name
ddlB
Definition
(GenBank) putative D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00473  D-Alanine metabolism
rle00550  Peptidoglycan biosynthesis
rle01100  Metabolic pathways
rle01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RL3301 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RL3301 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RL3301 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rle01011]
    RL3301 (ddlB)
Enzymes [BR:rle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RL3301 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:rle01011]
 Precursor biosynthesis
  Amino acid ligase
   RL3301 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 ATP-grasp GARS_A Arg_repressor
Motif
Other DBs
NCBI-ProteinID: CAK08788
GeneDB: RL3301
RhizoBase: RL3301
UniProt: Q1ME39
LinkDB All DBs
Position
complement(3460336..3461262)
Genome map
AA seq 308 aa AA seqDB search
MSRKHVAVLMGGFSSERPVSLSSGKACAEALEAEGFDVTRIDVARDVSEKLAALKPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKDKAKLVAAAAGITVAESQVVNR
FAFPSTHPMKPPYVVKPVREGSSFGVVIVTEDQAHPPQIVSSPEWRYGEEVIVERYVYGR
ELTCGVMGETPLGVTEVVPQGHNFYDYDSKYAAGGSKHVIPAKISPNIYQKIQTLSLRAH
QAIGCRGVSRSDFRYDDRFSEDGEIIWLEVNTQPGMTPTSLVPEMAGHAGYSFGQFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaagcatgtcgcggtcctgatgggcggattttcctcggaaaggcctgtcagc
ctttcctcgggaaaggcttgcgcagaagccctcgaggcggagggattcgacgtgacgcgc
atcgacgtggcgcgcgacgtttccgagaaactcgctgcgctgaagcccgatgtcgtcttc
aatgcgcttcacggcccgttcggcgaggacggcaccattcagggcatcctcgaatatctc
gaaatcccctatacgcattcgggcgtgcttgcctcggcgctggcgatggacaaggacaag
gcgaagctcgttgccgccgctgccggcattacggtcgccgaatcgcaggtggtcaaccgt
ttcgcctttccctcgacgcatccgatgaagccgccctatgtggtgaaacccgtccgcgaa
gggtcgagcttcggcgtcgtcatcgtcaccgaagatcaggcgcatccgccacagatcgtc
agttcgcccgaatggcgctacggcgaagaggtgatcgtcgagcgctatgtttacggtcgc
gaactcacctgcggtgtcatgggtgaaactcccctcggcgtcacggaagtggtgccgcag
ggacacaatttttatgattacgactccaagtatgccgcgggcggttcaaaacacgtcatc
cccgcgaaaatttcaccgaatatttaccaaaaaatacaaacattgtccctaagggcgcat
caggcaatcggttgtcgcggcgtcagtcggtccgactttcgttacgacgatcgtttctcc
gaagacggcgaaatcatctggctggaggtcaatacccagccaggcatgactccaacctcg
ctcgtgcccgaaatggccggtcatgccggttattcatttggtcagtttctccggtggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system