KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3532Help
Entry
RL3532            CDS       T00402                                 

Gene name
tdk
Definition
(GenBank) putative thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00240  Pyrimidine metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RL3532 (tdk)
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RL3532 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: CAK09020
GeneDB: RL3532
RhizoBase: RL3532
UniProt: Q1MDF7
LinkDB All DBs
Position
complement(3707837..3708439)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPHEDLFRLVATLSGEGAPISCIFVDEAHFMTPVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAEGKVLHEGAQIDVGGNEKYV
SLCRRHWDDAMNGTWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactactcgacgatgaacgccggcaagtcgacgatgctgctg
caggcctcctataattaccaggagcgcggcatgcgcacggtgcaactgatcgcagccttc
gacgagcgcgcgggccgaggcgtcatcggctcgcggatcgggctggaggcgagcgccatt
cccttcgagccgcatgaggatctgttccggttggtcgcgacgctgagcggcgaaggggcg
ccgatttcctgcatcttcgtcgacgaggcgcatttcatgacgcctgtccatgtctggcag
cttgctcgcgtcgtcgacaggctcggcatccctgtgatggtctacgggctgagaaccgat
ttccagggcaagctgtttccggcctcgcaggaactgcttgcgatcgccgacgaaatgcgc
gaggtgcgcacgatctgccattgcgggcgcaaggcgacgatggttgtgcggctcgacgcg
gaaggaaaagtattgcacgaaggcgcgcagatcgatgtcggcggcaacgagaaatatgtc
tcgctctgccgcaggcactgggacgacgcgatgaacggtacctggatcgccgagccggtc
tga

DBGET integrated database retrieval system