KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4267Help
Entry
RL4267            CDS       T00402                                 

Gene name
acoD
Definition
(GenBank) putative acetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00010  Glycolysis / Gluconeogenesis
rle00620  Pyruvate metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL4267 (acoD)
   00620 Pyruvate metabolism
    RL4267 (acoD)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RL4267 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAK09756
GeneDB: RL4267
RhizoBase: RL4267
UniProt: Q1MBC7
LinkDB All DBs
Position
4525038..4526546
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVESPFKLKYGNYIGGEWREPVEGKYFENLTPVTGGKLCDIPRSNEKDINLALDA
AHAAKEKWGRTSAAERSNILMKIAQRMEDKLELLAQAETWDNGKPIRETMAADIPLAIDH
FRYFASCIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALAAGNC
VVLKPAEQTPASILLWAELVGDLLPPGVLNIVNGFGLEAGKPLATSPRVAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMEKAVKRVEAIKQGNPLDTATMIGAQASSEQLEKILAYLDIGKQEGA
EVLTGGARNDLGGELANGYYVKPTIFKGHNKMRVFQEEIFGPVVSVTTFKDEKEALEIAN
DTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatcagaaaatcgtcgagtcgccgttcaagctgaaatacggcaactatatcggc
ggcgaatggcgcgagccggtcgaggggaaatacttcgaaaacctcacgcccgtcaccggc
ggcaagctctgcgacattccccgctccaatgaaaaggacatcaatctcgcgctcgacgcc
gcccatgcggctaaggaaaaatggggccgcacctccgctgccgagcgctccaatatcctc
atgaagattgcccagcgcatggaagacaagctggagttgctcgcccaggccgagacctgg
gacaacggcaagccgatccgcgaaaccatggccgccgacattccgctggcgatcgaccat
ttccgttatttcgcctcctgcatccgcgcccaggaaggttcgatcggcgagatcgaccac
gacaccgtcgcctatcacttccatgaaccgctcggcgtcgtcggccagatcattccgtgg
aacttcccgatcctgatggcgacctggaagctggcgccggcacttgccgccggcaactgc
gtcgtgctgaagcccgccgaacagacaccggcttcgatcctgctctgggccgaactcgtc
ggcgatctcctgccgcccggcgtgctcaacatcgtcaacggcttcggccttgaagccggc
aagccgctggcaaccagcccgcgcgtcgccaagatcgccttcaccggcgagacgacgaca
ggccggctcatcatgcaatatgccagccagaacctcattccggtgacgctggagctcggc
ggcaaatcgccgaacatcttcttcgccgatgtgatggctgaagatgacgacttcctcgac
aaggcgctcgaaggctttgcgatgtttgccctcaatcagggcgaagtctgcacctgcccg
agccgcgccctcgtccaggaatcgatctacgaccgcttcatggaaaaggccgtcaaacgc
gttgaggcgatcaagcagggcaacccgctcgacaccgcaacgatgatcggcgctcaggcc
tctagcgagcagttggaaaaaatcctcgcctatctcgatatcggcaagcaggaaggcgcg
gaagtgctgaccggcggcgcgcgcaacgatctcggcggcgagttggcgaatggctattat
gtcaagccgacgatcttcaagggtcacaacaagatgcgtgtgttccaggaggagatcttc
ggaccggtggtttcggtcacgaccttcaaggacgagaaggaggcgctcgaaatcgccaac
gacacgctctacggtctaggcgccggtgtctggagccgcgacgccaatcgctgctaccgt
ttcggccgcgagatccaggccggccgcgtctggaccaactgctaccacgcctacccggcc
catgccgccttcggcggctacaagcagtcgggcatcggtcgtgaaacccacaagatgatg
ctcgaccactaccagcagaccaagaacatgctggtgagctacagcccgaaagcgcttggc
ttcttctga

DBGET integrated database retrieval system