KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL100345Help
Entry
pRL100345         CDS       T00402                                 

Definition
(GenBank) putative nitrate transporter permease component
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00910  Nitrogen metabolism
rle02010  ABC transporters
Module
rle_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    pRL100345
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    pRL100345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rle02000]
    pRL100345
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    pRL100345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CAK10571
GeneDB: pRL100345
RhizoBase: pRL100345
UniProt: Q1M7G1
LinkDB All DBs
Position
pRL10:356049..356942
Genome map
AA seq 297 aa AA seqDB search
MSALANKENPSTAASAKLAAKVLPFSGKHGSRIDFRRAALTALRNVVPPLVVLALILLVW
QVLCSSADASLPSPHRVWQDSYDLIAYPFFNYGSQDIGLGWRVLISLQRVLYGFGLAAVT
GVIVGAIIGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDSNPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVAEVLRLNQFEFFWKIMLPSAAPYIFTGLRIGVGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGIVGFALDKLVAALGKLITRGAMAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccctggcaaataaagaaaatccttccacggccgcctctgccaagctggcggca
aaggttctgccattttccggcaagcatggatcgcggatcgattttcgtcgagcggcactg
accgcacttcgcaacgtcgttccgccactcgtcgtgctggcactcatcctgctcgtctgg
caggtgctctgttcatcggcggatgcgtctttgccctcgccgcatcgggtctggcaggat
agctacgacctgatcgcctatccgtttttcaactacggctcccaggatatcgggctcggc
tggcgcgtactcatttcgctgcagcgcgttctctatggctttggccttgccgcggtcacc
ggagtcatcgtcggggcgatcatcggccagtcggtctgggcgatgcgtggcctcgatccg
atcttccaggtgctgcgcacggttccgccgctcgcctggctgccgctgtcgctcgcagcc
ttccaggattccaacccctcggcgatcttcgtgatcttcatcacgtcgatctggccggtg
atcatcaacaccgccgtcggcgtccgcaatattccgcaggattaccgcaatgtcgccgag
gtgctgcgcctcaaccagttcgagtttttctggaagatcatgctgccttcggcagcgcct
tacatcttcaccggcctcaggatcggcgtcggcctctcctggctcgccatcgttgcggcc
gaaatgctgacgggcggcgtcggcatcggcttcttcatctgggacgcatggaactcgtcg
cgccttccggacatcatcgtcgcgctcgcctatatcggcatcgtcggcttcgccctcgac
aagctggtggcagcactcggcaaactcatcacccgcggcgccatggccaactga

DBGET integrated database retrieval system