KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL100389Help
Entry
pRL100389         CDS       T00402                                 

Gene name
idnD
Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    pRL100389 (idnD)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     pRL100389 (idnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Methyltransf_25 ADH_zinc_N_2 Methyltransf_11 MTS PrmA AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CAK10615
GeneDB: pRL100389
RhizoBase: pRL100389
UniProt: Q1M7B7
LinkDB All DBs
Position
pRL10:complement(405420..406451)
Genome map
AA seq 343 aa AA seqDB search
MKAIVIHAAKDLRIEEREPEVAGAGQVEIAIEAGGICGSDLHYYNHGGFGTVRLREPMIL
GHEIAGTVKALGSGVADLAVGDRVAVSPSRPCNHCQYCLKGQQNHCLNMRFYGSAMPMPH
IQGGFRQRLVAERWQCHKVTDGISIHEAAFAEPFAVTLHAANRAGSLLGKRVLVTGCGPI
GMLAIVAARVLGAREIVATDVTDSVLAIARTSGADRTINVATHAADLAAYSADKGYFDVM
FEASGNERAVRAGLETLKPRAILVQLGLGGDVSIPQNMIVAKEIEMRGTFRFHEEFALAV
ELINARRVDLKPLLTGVFGIEEAVAAFELAGDRSKSMKVQIAF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatcgtcattcatgctgccaaggatctgaggatcgaagagcgcgagccggag
gttgcgggcgccgggcaggtggagattgccatcgaagccggcggcatctgcggttccgac
ctgcattattacaatcacggcggtttcggcaccgttcgcctgcgcgaaccgatgatcctc
ggccatgagatcgccggcacggtcaaggcgctgggctccggcgtcgccgatcttgccgtc
ggagaccgtgtcgcggtttccccgagccggccgtgcaaccattgccaatattgcctgaag
gggcagcaaaaccactgcctcaacatgcggttttacggcagcgccatgccgatgccgcat
attcagggcggttttcgccagcggctggtggcagagcgttggcagtgccacaaggtcact
gacggcatttccattcacgaggccgcctttgccgaaccctttgccgtgacgctgcatgcg
gcaaaccgcgccggctcgctgctgggcaaacgcgtgctggtcaccggttgcggccccatt
gggatgttggcgatcgtcgcggcgcgcgttctcggcgcccgcgaaatcgtcgcgaccgac
gtgacggacagcgttctggcaatcgcccgcaccagcggcgccgatcgaacgatcaatgtt
gccacccatgctgccgaccttgcggcttacagcgctgacaagggatatttcgatgtcatg
ttcgaagcgtcgggcaatgagagggccgtgcgcgccggcctggagacgcttaagccccgc
gccattctcgtgcagctcggccttggcggcgatgtctcgatcccgcagaacatgatcgtg
gcgaaggaaatcgagatgcgcggcacattccgttttcacgaggaatttgcgctcgccgtc
gaactgatcaacgcgcgtcgcgtcgatctgaagccgctgctgaccggtgtctttgggatc
gaagaggccgtcgcggccttcgaattggcgggcgaccgcagcaagtccatgaaagtgcag
attgctttctga

DBGET integrated database retrieval system