KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120136Help
Entry
pRL120136         CDS       T00402                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00970  Aminoacyl-tRNA biosynthesis
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    pRL120136
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rle03029]
    pRL120136
Enzymes [BR:rle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     pRL120136
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     pRL120136
Mitochondrial biogenesis [BR:rle03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    pRL120136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAK11850
GeneDB: pRL120136
RhizoBase: pRL120136
UniProt: Q1M4W9
LinkDB All DBs
Position
pRL12:complement(136751..138124)
Genome map
AA seq 457 aa AA seqDB search
MTLSYGSLSIAQLSTLIQGGSVDPVTVAEQVLDAIESHDDKAVFISLTRERAMAEAHASS
KRLNDGRSLGLLEGIPVAWKDLFDVAGSVTAAGSRLLLRDQAPAAVDAAVVSALASAGMV
ATGRVNMSEFAFSGLGINPHFGTPKNPRSTDVARIPGGSSSGSGVAVASALVPVSIGSDT
GGSVRIPAALNGIVGYKATRGRYPMTGVFPLSGSLDSLGPLCRSVQDAIWIDAAMRGAMA
PTASRRPLAGLEVVIPTNVVFDDAEPGVVAAFEAAVERLSAAGVMFTRLEIPAFAEILQL
MASHGALVTAEAYWLHKARITGPDAGLIDPRVVSRTRFGEEITLPHYLDILSARKRLIEA
VDRLVGDRLIAFPTVAHVAPLLEPLKTDDQLFVATNGKTLRNTLLGNFLDWCGVSIPCGA
GDAGMPVGFLLSGLARGDERLLSVALVAEPVIRGETI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttcttacggctccctctcgatcgcccagctctccaccctcatccagggcggc
agtgtcgatcctgtcacggtggcagagcaggtcttggacgcgatcgagagccatgacgac
aaggcggtcttcatctcgttgacgcgggagcgggcaatggcggaagcgcatgcctcgtcg
aagcggctgaatgacggtcgttcgcttggcttgctcgaaggcattccggttgcctggaag
gatctcttcgatgttgccggcagcgtcacggcggcggggtccaggctgcttctacgtgat
caggcaccggccgcagtcgacgccgccgtcgtctccgcgctggcttcggcgggtatggtg
gcgacgggccgggtcaatatgagcgagttcgccttttccggccttggcatcaatccgcat
ttcggcacgccgaaaaaccctcgcagcaccgatgtcgcccgcattccgggcggctcgtcc
tccggttcgggcgtggcggtggcatcagctctcgtgccggtctcgatcggctccgacaca
ggtggttcagtgcggatcccggcggcgctgaacggcatcgtcggctacaaggcgacgcgc
ggacgatacccgatgacaggcgtgttccccctttccggcagcctcgattcgctcgggccg
ctctgccgttcggtgcaggatgccatctggatagacgccgcgatgcgcggagccatggcg
ccgacggccagtcgccgtccgctcgccgggctggaggtcgtcatccccaccaacgtcgtc
ttcgacgatgccgagccgggtgtcgttgcggccttcgaagcggcggttgagcgtttgtcc
gccgccggcgtcatgttcacgcggctggagatcccggccttcgcggaaattctgcagttg
atggcaagccacggagccctggtgacggcggaggcctactggctgcacaaggcgcggatc
accgggcctgatgccggactgatcgacccgcgtgtggtctcgcgcacccgcttcggtgag
gagatcacccttccgcactacctcgacatactctctgcccgcaagcggctgatcgaagcg
gtggaccggctggtcggcgaccgcctgatcgccttcccgacggtcgcgcatgtggcaccg
ttgctcgagccgctgaagaccgatgaccagcttttcgtggcgaccaacggcaagacactg
cgcaacacgctgctcggcaattttctggactggtgcggggtgtcgatcccttgcggggca
ggcgacgccggcatgccggtcggcttcctgctgtcggggctggcgcgcggcgacgagcgg
ctgctgtcggtggcgctcgtcgccgaaccggtcattcgcggcgagacaatttga

DBGET integrated database retrieval system