KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120396Help
Entry
pRL120396         CDS       T00402                                 

Gene name
cbbl1
Definition
(GenBank) putative ribulose bisphosphate carboxylase large chain 1
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00630  Glyoxylate and dicarboxylate metabolism
rle01100  Metabolic pathways
rle01120  Microbial metabolism in diverse environments
rle01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    pRL120396 (cbbl1)
Enzymes [BR:rle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     pRL120396 (cbbl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAK12105
GeneDB: pRL120396
RhizoBase: pRL120396
UniProt: Q1M467
LinkDB All DBs
Position
pRL12:complement(428905..430200)
Genome map
AA seq 431 aa AA seqDB search
MAICVARGATASFMMITLTYRIETPGSVEAMAEKIASDQSTGTFVPVPGETEELKSRVAA
RVLAIRPLEGASHPTWPEVAPGTLLHRADVDIAFPLDAIGTDLSALMTIAIGGVYSIKGM
TGIRIVDLTLPEAFKSAHPGPQFGIPGSRRLAGVEGRPIIGTIVKPALGLRPHETAELVG
ELISSGVDFIKDDEKLMSPAYSPLKDRVAAIMPRILDHEQKTGKKVMYAFGISHADPDEM
MRNHDIVAKAGGNCAVVNINSIGFGGMSFLRKRSNLVLHAHRNGWDVLTRDPGAGMDFKV
YQQFWRLLGVDQFQINGIRVKYWEPDDSFVSSFKAVSTPLFDASDCPLPVAGSGQWGGQA
PETYHRTGRTIDLLYLCGGGIVSHPGGPAAGVRAVQQAWQAAVADIPLEVYARDHPELAA
SIAKFSGGKGA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctgcgtggcgagaggagcaaccgccagtttcatgatgattaccctgacctac
cgtatcgaaacgcccggcagcgtcgaggcgatggcggaaaagatcgcgagcgaccagtcg
acgggaaccttcgttcccgtccccggcgagaccgaagagctgaaatcgcgtgtcgccgcc
cgtgtcctggcgatccgtccgctcgaaggcgccagtcatccgacctggcccgaggtcgcc
cccggcacgctgcttcatcgcgccgatgtcgacatcgcctttccgctggacgcgatcggc
acggacctttcggcattgatgaccattgcgatcggcggcgtctattccatcaagggcatg
accggcatccgcatcgtcgacttgacgctgcccgaagccttcaagagcgcgcatccggga
ccacagttcggcatccctggaagccgccgcctcgccggcgtcgaaggtcgccccatcatc
ggaacgatcgtcaagccggcgcttggtctcaggccccacgaaacggcggaactcgtcggc
gagttgatctcatccggcgtcgacttcatcaaggatgacgaaaaactgatgagccccgcc
tattcgccgctcaaggaccgcgttgcggcgatcatgccgcgcattctcgatcacgagcag
aagaccggcaagaaggtcatgtatgccttcggcatctcgcatgccgaccccgacgagatg
atgcgcaaccacgacatcgtcgccaaggccggcggcaactgcgccgtcgtcaacatcaac
tcgatcggcttcggcggcatgagctttctgcgcaagcgctccaatctagtgctgcacgcg
catcgaaacggttgggacgtgctgacgcgcgatccgggcgccggcatggatttcaaggtc
taccagcaattctggcggctgctgggggtcgatcagtttcagatcaacggtatcagggtc
aaatattgggagccggacgacagtttcgtctcgtccttcaaggccgtcagcacgccgctc
ttcgacgcctccgattgcccgcttccggttgccggttcgggccagtggggaggacaggcg
cctgagacctatcaccggaccggccgcaccatcgatcttctctatctctgcggcggcggc
atcgtcagccaccccggcggcccggcggccggcgttcgggccgtgcagcaggcatggcag
gcagccgtcgcagacatcccgttggaggtctatgcccgggatcacccggaactcgccgcc
tcgattgcaaaattcagcggcggcaagggcgcgtga

DBGET integrated database retrieval system