KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120709Help
Entry
pRL120709         CDS       T00402                                 

Gene name
treS
Definition
(GenBank) putative trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00500  Starch and sucrose metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    pRL120709 (treS)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     pRL120709 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     pRL120709 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CAK12418
GeneDB: pRL120709
RhizoBase: pRL120709
UniProt: Q1M3A8
LinkDB All DBs
Position
pRL12:769420..772701
Genome map
AA seq 1093 aa AA seqDB search
MDTMNADSAPQPLWYKDAIIYQLHIKSFYDANGDGVGDFAGLHQKLDHIAALGVNAIWLL
PFFPSPRRDDGYDIADYGSVSPDYGTVEDFQAFVDAAHQRNIRVIIELVINHTSDQHPWF
QRARQAPAGSPERGFYVWSDTDQKFPETRIIFIDTEKSNWTWDAVAGAYYWHRFYSHQPD
LNFDSPLVMEELLRVMRFWLETGIDGFRLDAIPYLVEREGTINENLPETHAILKRIRAAL
DATHPGVMLLAEANQWPEDTREYFGEGDECHMAFHFPLMPRMYMAIAKEDRFPITDILRQ
TPEIPDNCQWAIFLRNHDELTLEMVTDAERDYLWETYASDKRARINLGIRRRLAPLMERD
RRRIELMNALLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRADPA
RLVLPPVADPLYGFEAVNVEAQSTDAHSLLNWTRRMLALRGRHPAFGRGTLRFLSPENRK
ILAYLREYEGEVLLCVASLSRLPQAVELDLSSFEGRVPIELTGMSPFPPIGQLTYLLTLP
PYGFFWFQLTADADPPAWRTAPPEQLPDLLTMVLRRSLLDLVDEPGHARILSGEILPAYL
SRRRWFGAKDQPLQAARLISVTPIPFADGVVLGELEVVLPNHSESYQLPLAVAWDDAHPS
ALAQQLALGRIRQGRRVGFLTDGFAVEAMARGILHGLRDRSRTTGRTGTLEFLGTEQLDS
LDISGELPVHWLSAEQSNSSLLVGDVAMIKLIRHIFPGIHPEVEMTRYLTRAGYDHTAPL
LGEVAHTDSSGRRSTLIIVQGAIRNQGDAWNWMLNNLRRGADELVLNDPAVQPDDDVFRS
LISFVAMVGLRLGELHVVLAAKTGDEAFSPVVAGDSEVEAMRKAVVGELAYAMSKLDERD
ENADPAIDLLAAPLLERRSELAELAGTLAESSRYTLMTRTHGDFHLGQILVSEGDAVIID
FEGEPAKNLTERRAKTNPLRDVAGLLRSLSYLVATAQLDNDAVIEHDNEVRREAIARFGR
NAEEAFLDAYSQAVSVSKELDMPPDQRRRILDAFLLEKAAYEIAYEARNRPKWLPIPLSG
LTEIVSRLAGVTA
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggacacgatgaatgcagatagcgcgccgcagccgctctggtacaaggatgcgatcatc
taccaactgcacatcaagtcgttctacgacgccaatggcgacggggtcggcgatttcgcc
ggcctgcaccagaagctcgatcacatcgcagccctcggcgtcaatgccatctggcttttg
cctttctttccctctccgcgccgagacgacggctacgacatcgccgactatggcagtgtc
agtcccgattacgggacggtcgaggacttccaggcttttgtcgacgccgcccaccagcgc
aatatccgcgtcatcatcgaactcgtcatcaatcacacctccgatcagcatccctggttc
cagcgtgcgcgccaggcgccggcgggatcgccagagcgcggcttctacgtctggtccgat
accgatcagaaatttccggaaacgcggatcattttcatcgatacggaaaaatccaactgg
acatgggacgccgtcgccggcgcctactactggcaccgcttctattcccatcagcccgac
ctcaatttcgatagtccccttgtcatggaggaattgctgagggtgatgcgcttctggctg
gaaaccggcatcgacggttttcgtctcgacgcgatcccctacctcgtcgagcgcgagggg
acgatcaacgaaaacctgccggaaacccacgcgatcctcaaacgcatacgcgccgcgctc
gatgccacccatcccggcgtgatgctgcttgccgaggccaatcaatggccagaggacaca
cgcgaatatttcggagagggtgacgaatgccacatggccttccacttcccgttgatgccg
cgcatgtatatggcgatcgccaaggaggaccggtttccgatcaccgatatcctgcgccag
acgccggagattccagacaactgccaatgggcgatcttccttcgcaaccacgacgagctg
acgctcgaaatggtgaccgacgccgagcgggattatctctgggagacctatgcatccgac
aaacgtgcccgcatcaatctcggcataaggcggcgcctggcgccgttgatggagcgcgac
cgccggcggatcgagctgatgaacgcgcttcttctctcgatgccgggaacgccggtgatc
tattacggtgacgagatcggcatgggcgataatatctatctcggcgaccgggatggggtg
aggacgccgatgcaatggtctccggaccgcaatggcggtttctccagggcagatccggcg
cgtctcgtcctgccgcccgtcgccgacccgctttatggctttgaagccgtcaacgtcgag
gcgcagagcacagacgcgcattcgctgctcaactggacgcgcagaatgttggcgttgcgc
ggcaggcatcccgccttcgggcgtggcacgctgcggttcctttcaccggaaaatcgcaag
atccttgcctatctcagggagtatgaaggcgaggtcttgctttgtgttgccagtctctcg
cggctgccccaggccgtcgaactcgacttgtcgagcttcgaggggcgcgttcccattgaa
ctgaccggcatgtcgccgtttccgccgatcggccagttgacctatcttctgaccttgccg
ccctacggtttcttctggttccagctgacggctgatgccgatccgccggcgtggcgcacc
gcaccgccggaacagcttcccgatctgttgacgatggtcctccggcgtagcctgctcgac
ctcgtggatgaaccgggtcatgcacgtatcctgagcggcgaaatcttgcccgcctatctc
tccaggaggcgatggttcggggcaaaggaccagccgcttcaggccgcccgactgatctcc
gtgacaccaatcccattcgccgacggtgtcgtcctcggcgagttggaggtcgtgctgccg
aaccacagcgaatcctaccaactgccgctcgcggtcgcctgggacgatgcccacccttcc
gcgcttgcccagcagcttgcgcttgggaggattcgccaaggtagacgcgtcggtttcctc
acagatggattcgccgtggaggcaatggcgcgcggcattctgcacggacttcgcgaccgc
tcgcgcaccaccggccggaccggcacgctcgaattccttgggacagaacagctcgacagt
ctcgatatctcaggtgagctgccggtgcattggctatcggctgaacagtccaacagctcg
ctgctcgtcggcgacgtagcgatgatcaaactgatcaggcacatcttcccgggcatccat
ccggaagtcgagatgacgcgctatctcacccgcgccggctatgaccacacagcgccgctg
ctcggcgaggtcgcgcataccgattccagcggacgccgttccaccttgatcatcgtccag
ggcgcgatccgcaatcagggtgacgcctggaactggatgctgaacaatctgcgccgcggg
gccgacgaactggtcctgaacgatccggcggtccaaccagacgacgacgtcttccggtcg
ctgatcagcttcgtcgcgatggtgggtctcaggctcggcgaattgcatgtcgtgctcgct
gcgaagaccggagacgaggccttcagcccggtggttgctggcgacagcgaggtcgaggcg
atgaggaaggccgttgtcggggaactcgcctatgccatgtcgaagctcgatgaacgcgac
gagaatgccgatcccgcaatcgacctgctcgcagcaccgcttctcgagcgtcgttccgaa
ctcgcagagctcgccgggacgctggcggagagctcccgctatacgctgatgacacgcacg
catggcgacttccatcttggccagatcctcgtcagcgagggtgatgccgtcatcatcgac
ttcgagggcgagcccgcgaaaaacctgaccgagcgccgcgccaagacgaacccgttgcgt
gatgtcgccgggcttttgagatcgctgagctatctcgtggccaccgcgcagctcgataac
gacgcggtcatcgaacacgacaacgaggttcgccgcgaggcgatcgctcgcttcgggcgc
aatgccgaggaggcctttctggatgcctattcgcaggcggtctccgtatcgaaagagctt
gacatgccgcccgatcaaagacggaggattctcgatgcttttcttctcgaaaaggccgcc
tacgagatcgcctacgaagctcgcaacaggccgaaatggcttccgatcccgctatccggc
cttaccgaaatcgtatcgcgtctggcgggggtcacagcatga

DBGET integrated database retrieval system