KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL90074Help
Entry
pRL90074          CDS       T00402                                 

Gene name
glyD
Definition
(GenBank) putative aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00564  Glycerophospholipid metabolism
rle01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    pRL90074 (glyD)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     pRL90074 (glyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: CAK03785
GeneDB: pRL90074
RhizoBase: pRL90074
UniProt: Q1M8P2
LinkDB All DBs
Position
pRL9:74157..75710
Genome map
AA seq 517 aa AA seqDB search
MCDAKSTAGSEGELGRNIHDIFVIGGGINGCGIARDAVGRGYSVALAEMKDFASGTSSGA
TKLIHGGLRYLEHYEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLG
LFLYDHLGGRKLLPPTAVLDMRRDPAGKPLKALFSKAFEYSDGWVDDARMVVLNARDAAD
KGALIMPRTKVVSARRENGLWHIETTDTVTGRNDSHQARMLVNAAGPWVDHVIRSAFGQN
EAHHVRLVQGSHIVVKKKFDDARAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPRD
VRISEEETVYLCNAASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLEGE
GDAAPLLNVFGGKLTTYRRLSEHALEKIGAAIGAKGAPWTAKSHLPGGDFPVRGYEAQVD
KLRRRYSFLADPLARRLVRRYGTKAELLLGNASGIDDLGRLFGGDLYEAEVTYLVEHEWA
RHAEDVLWRRTKDGLRLSKEQAQSLEEYMAAMPAMAG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgatgcgaaatcgacggcgggctcggagggggaattgggccgaaatattcacgac
atattcgtcatcggtggcgggatcaacggctgcggcattgcgcgcgatgctgtcgggcgc
ggttattcggtggcgctggcggaaatgaaagatttcgcctcgggtacctcgtcgggcgcc
accaagctgatccatggcggcctgcgttatctcgagcattacgagttccgcctggtgcgt
gaatcgctgatggagcgcgagatcctctgggcgatggcgccgcacatcatctggccgctg
cgtttcgtactgccctaccacaaaggcggcatccgcccggcctggctgatccggcttggc
ctcttcctttacgatcatctcggcggtcgcaagctgctgccgccgacagccgtgctcgac
atgcgccgcgatccggccggcaagccgctgaaggcgctgttttccaaggccttcgaatat
tccgacggctgggtcgacgatgcccgtatggtggtgctgaacgcccgcgatgccgccgac
aagggcgcgctgatcatgccgcgcaccaaggtggtgtcggcaaggcgcgagaatggcctg
tggcatattgagaccaccgataccgtcaccggtcgcaatgacagccatcaggcccgcatg
ctggtcaatgccgccggtccttgggtcgaccatgtcatccgttccgccttcggccagaac
gaagcccatcatgtccgcctcgtccaaggcagccatatcgtcgtgaagaagaaattcgac
gatgcgagagcctatttcttccagaatcccgacaaccgcatcatcttcgccatcccctac
gagggcgacttcaccctgatcggcaccaccgaccgcgactacaccgccgatccccgggat
gtccggatctccgaggaggagaccgtctatctttgcaatgcggcgtctgaatatttcaag
gagccggtcaggccggaggatatcgtctggacctattcggcggtcaggccgctttatgac
gacggcgcctcaaaggcgcaggaggcgacgcgcgactatgtgctgaagctggaaggtgaa
ggtgacgccgcgccgctgctcaacgttttcgggggcaagctcaccacctatcgccggctt
tccgaacatgcgctggagaagatcggtgctgcgatcggcgccaagggtgccccgtggacg
gccaaaagccatctgccgggcggcgatttcccggtccgcggttacgaggcacaggttgac
aagctgaggcggcgttattcgttcctcgccgatccgcttgcccgccgcctggtgcgccgc
tacggcaccaaggcggagctgttgcttggcaatgccagcggcatcgacgatctcggacgg
ctgttcggcggcgatctctacgaggcagaggtcacctatctcgtcgaacatgaatgggcc
cggcacgccgaagacgtgctgtggaggagaacaaaggatggtctgcgcctttcgaaggag
caggcccagtcactggaggagtacatggctgccatgccggcgatggccgggtag

DBGET integrated database retrieval system