KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1248Help
Entry
Rleg_1248         CDS       T00926                                 

Definition
(GenBank) adenylate/guanylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00230  Purine metabolism
rlg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rleg_1248
Enzymes [BR:rlg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Rleg_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc DUF4407
Motif
Other DBs
NCBI-ProteinID: ACS55540
UniProt: C6AU38
LinkDB All DBs
Position
complement(1226304..1227365)
Genome map
AA seq 353 aa AA seqDB search
MREISPTQNWILITIVLAASGVIYDLMFYSNQTPIVGAIFALFIGMPILAFERKVLFRAL
YRRIQKLPTFAFIITELLIYEILMSIGFACAGLLLWSLGMVKPASLLDLVIMPFEVFVYA
LAVCTMLIFVLRVRELLGREVFLSMLISRYRNPVKEERVFLFIDLVDSTAFAEKHGDLRA
QQLLSSLFATFAEPVRRHKGMINDYVGDAAIITWPLTRGVKNARCVRCMFDILADIEANA
AGWRKNYGQVPKLRAALHGGEIITAEIGVDHHKISYFGDTVNTTARLETLCRSLNRSVLI
SSELARRMEFPDEISCEDLGTHAVKGRGQALGVMALSSRAVTVLNAPAVILHG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaaatatctccgacacagaattggatcctgatcacgatcgtccttgcggccagc
ggcgtcatctatgatctgatgttctactccaatcagacaccgattgtcggggcgatcttc
gcgctcttcatcggcatgccgatcctcgccttcgagcgtaaggtgctgtttcgagcactc
tacaggcgcatccagaagctgccgaccttcgccttcatcatcaccgagctgctgatctac
gaaatcctgatgagcatcggctttgcctgcgccggcctgctgctctggtcgctcggcatg
gtgaagccggcgtcgctcctcgacctcgtcatcatgccgttcgaagtcttcgtctatgcg
ttggcggtctgcaccatgctgatcttcgtcttgcgcgtgcgagaactgctcggtcgtgaa
gttttcctcagcatgctcatcagccgctaccgcaatccggtcaaggaagagcgcgtcttt
ctgttcatcgacctcgtcgattcgacggcttttgccgaaaagcacggcgacctcagggcg
caacagctgctgagctcgctgtttgcaaccttcgccgagcccgtcaggcgccacaagggc
atgatcaatgactatgtcggcgatgcagcgatcatcacctggccgcttacccgcggcgtc
aagaatgcgcgctgcgtgcgctgcatgttcgatatccttgccgatatcgaagccaatgcc
gccggctggcggaaaaattacgggcaggtaccgaagctccgcgccgcccttcacggcggc
gagatcatcaccgccgaaatcggtgtcgatcatcataagatcagctatttcggcgatacg
gtgaacaccactgcccggctggagacgctctgccgcagtctgaaccgatcggttctgata
tccagcgagcttgcccggcgcatggagtttcctgacgagatatcctgcgaggatctcggc
acccatgccgtgaagggacgcggtcaggcactcggcgtcatggcgctttcctcgcgcgcg
gtcaccgtgctgaacgcgccggccgtcattctgcacggctga

DBGET integrated database retrieval system