KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2166Help
Entry
Rleg_2166         CDS       T00926                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rleg_2166
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlg02000]
    Rleg_2166
Enzymes [BR:rlg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rleg_2166
Transporters [BR:rlg02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rleg_2166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ACS56443
UniProt: C6AZN9
LinkDB All DBs
Position
2156891..2157517
Genome map
AA seq 208 aa AA seqDB search
MTEELVFYTNPMSRGRIARWMLEEIGQPYRTEYLTFGETMKAPEYLSVNPMGKVPAIRHG
DTVVTECAAICAYLAETFPDKALAPRPEERADYYRWMFFAAGPLESAVTMKALGFEIPQE
RLRMAGCGGFGDVMNTLEKAVSGSTYVTGERFTAADVYVGSHIAWGLGFGSIEKRQAFID
YFGRINEREAYKRANALDDEAIKTMQAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagaactggtattctataccaacccgatgtcgcgcggccgcatcgcgcgctgg
atgctggaagagatcggccagccctaccgcaccgaatacctgaccttcggcgagacgatg
aaggcgccggaatatctctccgtcaatccgatgggcaaagtgccggcgatccgccacggc
gataccgtcgttaccgaatgcgcggcgatctgcgcctatctcgccgaaacctttcccgac
aaggcgctggcgccgaggccggaagagcgcgcggattactaccgctggatgttctttgcc
gccggtccgctcgaatcggcggtgaccatgaaggctctcggcttcgaaattccgcaggaa
cgcctgcgcatggccggctgcggcggcttcggcgacgtgatgaacacactcgagaaagcc
gtctccggttcgacctacgtcaccggcgagcgcttcaccgccgccgacgtctatgtcggc
tcccatatcgcctggggcctcggcttcggctccatcgagaagcgccaagccttcatcgac
tatttcggccgcatcaacgagcgcgaggcctacaagcgggcgaacgccctcgatgacgaa
gccatcaagaccatgcaggccgcttga

DBGET integrated database retrieval system