KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2206Help
Entry
Rleg_2206         CDS       T00926                                 

Definition
(GenBank) Malate dehydrogenase (decarboxylating)., Phosphate acetyltransferase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00620  Pyruvate metabolism
rlg01100  Metabolic pathways
rlg01120  Microbial metabolism in diverse environments
rlg01200  Carbon metabolism
Module
rlg_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rleg_2206
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Rleg_2206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ACS56483
UniProt: C6AZS9
LinkDB All DBs
Position
2208396..2210708
Genome map
AA seq 770 aa AA seqDB search
MDHPEKSKTEKNLTSGDLDEQALFFHRYPRPGKLEIQATKPLGNQRDLALAYSPGVAAPC
LAIRDNPEMAAEYTSRANLVAVISNGTAVLGLGNIGPLASKPVMEGKAVLFKKFAGIDVF
DIEIDAPGVDQMVSTIASLEPTFGGINLEDIKAPECFEVERRLREKMKIPVFHDDQHGTA
IIVAAAILNGLELAGKNIADIKIVASGAGAAALACLNLLVILGAKRENIWVHDLEGLVYE
GRVELMDEWKSIYTQKSDTRTLAENIGGADVFLGLSAAGVLKPELLAQMADKPLIMALAN
PTPEIMPDLARAARPDAMICTGRSDFANQVNNVLCFPYIFRGALDCGAETINEEMKMAAV
RAIAALAREEPSDVAARAYSGETPVFGPDYLIPSPFDPRLILRIAPAVAKAAEQSGVARR
PIQDFDAYLDQLNRFVFRSGFVMKPIFTAAKAAERKRVIFSEGEDERVLRAAQVLLEEGL
AEPILIGRPQVIETRLKRYGLRIRPLQDFEVINPEDDPRFREYVDLYFSLVGRRGVIPEA
ARTIVRTNTTVIGALALRRGEADALICGLEGRYEKHLRDVRQIIGKRKNVRDFSALSLMI
SQRGATFFTDTYVTFNPTAEEVAEATVLAAEEIRRFGLTPRAALVSHSNFGSRESESATK
MRNALQLVREAAPDLEVDGEMHGESAITEALRKRVMPDTTLHDEANLLVFPNLDAANITL
GVVKSMTDGLHVGPILLGTALPAHILAPSVTSRGVVNMAALAVVEASQPA
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggatcacccggaaaaatcgaagacagaaaagaacctgacgagcggcgatctcgacgaa
caggcgcttttcttccaccgctatccccgccccggcaagcttgagatccaggcgacaaag
ccgctcggcaaccagcgcgacctggcgctcgcttattcgcccggcgttgccgccccttgc
cttgccatccgcgacaatcccgaaatggcggcagaatatacctcgcgcgccaatctcgtc
gccgttatctccaacggcaccgccgtgcttggcctcggcaatatcggcccgcttgcctcc
aaaccggtcatggagggcaaggccgtgctcttcaagaaattcgccggcatcgacgtattc
gatatcgagatcgatgccccaggcgtcgaccagatggtctcgaccattgcctcgctggag
ccgaccttcggtggtatcaacctcgaagacatcaaggcgccggaatgtttcgaggtcgag
cggcgcctgcgcgagaagatgaagatccccgtcttccacgacgatcagcacggcacggcg
atcatcgtcgccgccgcgatcctgaacgggctggaactcgccggcaagaacatcgccgac
atcaagatcgtcgcctccggcgccggtgctgccgcccttgcctgcctcaacctgctggtc
attctcggggcaaaacgcgaaaacatctgggtccacgatcttgaaggcctcgtctatgag
ggccgtgtcgagctgatggacgaatggaaatccatctatacccagaagagcgatacgcgc
acgctcgccgaaaatatcggcggcgccgacgtcttccttggcctttcggccgccggcgtg
ctgaagcccgagctgctggcgcagatggctgacaagccgctgatcatggcgctcgccaat
ccgacgccggagatcatgcccgatctcgcccgcgctgcccgtcccgacgcgatgatctgc
accggccgctcggatttcgccaaccaggtcaacaacgtcctctgcttcccctatatcttc
cgcggcgcgctcgattgcggcgccgagacgatcaatgaggaaatgaagatggcggccgtg
cgcgccatcgcagcccttgcgcgcgaagagccgtccgacgtcgccgcccgcgcctattcc
ggtgagaccccggtcttcggccctgactacctcatcccctcgcccttcgatccgcgcctg
atcctgcgcatcgcacctgcggtcgccaaggccgccgagcagagcggcgtggcgcgccgc
ccaatccaggatttcgacgcctatctcgaccagttgaaccgctttgtcttccgctccggc
ttcgtcatgaagccgatcttcaccgccgccaaggccgccgagcgcaaacgcgtcatcttc
tccgaaggcgaggacgagcgcgtgctgcgcgctgcccaggtgctgctcgaagaaggcctt
gccgaacccatcctgatcggacgcccgcaagtcatcgagacgcgtctgaagcgctacggc
ctgcgcattcggccgctgcaggatttcgaagtcatcaatccggaagacgatccgcgcttc
cgcgaatatgtcgatctctatttctccctcgtcggccgccgcggcgtcatcccggaagcc
gcccgcacgatcgtgcgcaccaacaccaccgtcatcggcgcgctggcgctgaggcgcggc
gaggccgatgctctgatctgcggcctcgaaggccgctacgagaagcatctgcgcgatgtt
cgccagatcatcggcaagcgcaagaatgtccgcgatttctcagccctcagcctgatgatc
tcgcagcgcggcgccaccttcttcaccgacacttacgtcaccttcaatccgaccgccgag
gaggtcgccgaggcgacggtgctggcggccgaagaaatccgccgtttcggcctcacgccg
cgcgccgccctggtttcgcattccaacttcggctcgcgtgaatccgaaagcgccacgaag
atgcgcaacgccctgcagctcgtgcgcgaagccgcgcccgaccttgaggtcgacggtgag
atgcacggcgaaagcgccatcaccgaagcactgcgcaagcgcgtcatgccggacaccacc
ctgcacgacgaagccaatcttttggtcttcccgaacctcgatgccgccaacatcaccctc
ggtgtggtcaagtcgatgaccgacggcctgcatgtcggcccgatcctgctcggcaccgcc
ctgcccgcccacatcctcgccccctcggtcacctcccgcggcgtcgtcaatatggcagcg
ctggccgtcgtcgaggcatcgcaaccggcttga

DBGET integrated database retrieval system