KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2848Help
Entry
Rleg_2848         CDS       T00926                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00473  D-Alanine metabolism
rlg00550  Peptidoglycan biosynthesis
rlg01100  Metabolic pathways
rlg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rleg_2848
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rleg_2848
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Rleg_2848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rlg01011]
    Rleg_2848
Enzymes [BR:rlg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Rleg_2848
Peptidoglycan biosynthesis and degradation proteins [BR:rlg01011]
 Precursor biosynthesis
  Amino acid ligase
   Rleg_2848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp GARS_A ATP-grasp_3 Arg_repressor CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACS57108
UniProt: C6ART3
LinkDB All DBs
Position
complement(2837281..2838207)
Genome map
AA seq 308 aa AA seqDB search
MSRKHVAVLMGGFSSERPVSLSSGKACAEALEAEGFDVTRIDVARDVSEKLAALKPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKDKAKLVAGAAGIPVAESQVVNR
FAFPATHPMKPPYVVKPVREGSSFGVVIVTEDQAHPPQIVSSPEWRYGEEVIVERYVYGR
ELTCGVMGETPLGVTEVVPQGHNFYDYDSKYAAGGSKHVIPAKISPNIYQKIQTLSLRAH
QAIGCRGVSRSDFRYDDRFSEDGEIIWLEVNTQPGMTPTSLVPEMAGHAGYSFGQFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaagcatgtcgctgtcctgatgggcggattttcctcggaaaggcctgtcagc
ctttcctcgggaaaggcttgcgcagaagccctcgaggcagagggcttcgacgtgacgcgt
atcgacgtggcgcgcgacgtttccgagaagcttgctgcgctgaagcccgatgtcgtcttc
aatgcgcttcacggcccgttcggcgaggacggcaccattcagggcatcctcgaatatctt
gaaatcccctatacgcattcgggcgtgcttgcctcggcgctggcgatggacaaggacaag
gcgaagctcgttgccggcgccgccggcattccggtggccgaatcgcaggtggtcaaccgt
ttcgcctttcccgcgacgcatccgatgaagccgccctatgtggtgaaacccgtccgcgaa
gggtcgagcttcggcgtcgtcatcgtcaccgaagatcaggcgcatccgccacagatcgtc
agctcgcccgaatggcgctacggcgaagaggtgatcgtcgagcgctatgtttacggtcgc
gaactcacctgcggtgtcatgggtgaaactccgctcggtgtcacggaagtggtgccgcag
ggacacaatttttatgattacgactccaagtacgcggcaggcggttcaaaacacgtcatc
cccgcgaaaatttcaccgaatatttaccaaaaaatacaaacattgtccctaagggcgcat
caggcaatcggttgtcgcggcgtcagtcggtccgactttcgttacgacgatcgtttctcc
gaagacggcgaaatcatctggctggaagtcaatacccagccaggtatgaccccaacctcg
ctcgtgcccgaaatggccggtcatgccggctattcgtttggtcagtttctccggtggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system