KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3091Help
Entry
Rleg_3091         CDS       T00926                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00240  Pyrimidine metabolism
rlg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rleg_3091
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Rleg_3091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACS57347
UniProt: C6AT75
LinkDB All DBs
Position
complement(3088945..3089547)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPHEDLFRLVATLSGDGAPISCIFVDEAHFMTPVHVWQLARVVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAKGKVLHEGAQIDVGGNEKYV
SLCRRHWDDAMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactactcgacgatgaacgccggcaagtcgacgatgctgctg
caggcctcctataattaccaggagcgcggcatgcgcacggtgcagctgatcgccgccttc
gacgagcgcgccggccgaggcgtcatcggctcgcggatcggcttggaggcgagcgccatt
cccttcgagccgcatgaagatctgtttcggttggtcgcgacgctgagcggagacggagcg
ccgatttcctgcatcttcgtcgacgaggcgcatttcatgacgcctgtccatgtctggcag
cttgcccgcgtcgtcgacaggctcggtatccctgtgatggtctacgggctgagaaccgat
ttccagggcaagctgtttccggcctcgcaggaactgctggcgatcgccgacgaaatgcgc
gaggtgcgcacgatctgccattgcgggcgcaaggcgacgatggttgtgcggctcgacgcg
aaaggaaaagtattgcacgaaggcgcgcagatcgatgtcggcggcaatgagaaatatgtc
tcgctctgccgcaggcactgggacgacgcgatgaacggtgcctggatcgccgagccggtc
taa

DBGET integrated database retrieval system