KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3801Help
Entry
Rleg_3801         CDS       T00926                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00010  Glycolysis / Gluconeogenesis
rlg00620  Pyruvate metabolism
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_3801
   00620 Pyruvate metabolism
    Rleg_3801
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Rleg_3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ACS58044
UniProt: C6AXC0
LinkDB All DBs
Position
3859630..3861138
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVESPFKLKYGNYIGGEWREPVEGKYFENLTPVTGGKLCDIPRSNEKDINLALDA
AHAAKEKWGRTSVAERSNILMKIAQRMEDKLELLAQAETWDNGKPIRETMAADIPLAIDH
FRYFASCIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALAAGNC
VVLKPAEQTPASILVWAELVGDLLPAGVLNIVNGFGLEAGKPLATSPRVAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAFEGFAMFALNQGEVCTCP
SRALVQESIYDRFMEKAVKRVEAIKQGNPLDSATMIGAQASTEQLEKILAYLDIGKQEGA
EVLTGGSRNDLGGELANGYYVKPTIFKGHNKMRVFQEEIFGPVVSVTTFKNEKEALEIAN
DTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttcatcagaaaatcgtcgagtcgccgttcaagctgaaatacggcaactatatcggc
ggcgaatggcgcgagccggtcgagggaaaatacttcgaaaacctcacgcccgtcaccggc
ggcaagctctgcgacattccccgctccaatgaaaaggacattaacctcgcactcgacgcc
gctcatgcggcaaaggaaaaatggggtcgcacctcggttgccgagcgctccaatatcctc
atgaagatcgcccagcgcatggaagacaagcttgaattgctcgcccaggctgagacctgg
gacaatggcaagccgatccgtgaaaccatggcggccgacattccgctggcgatcgaccat
ttccgttatttcgcctcctgcattcgcgcccaggaaggttcgatcggcgagattgaccac
gacactgtcgcctatcacttccatgagccgctcggcgtcgtcggccagatcattccgtgg
aacttcccgatcctgatggccacctggaagctggcgcccgcacttgccgccggcaattgc
gtcgtactgaaacccgccgagcagaccccggcctcgatcctggtctgggctgaactcgtc
ggcgatctcctgccggcaggggtcctcaacatcgtcaacggtttcggcctcgaagccggc
aagccgctggcgaccagcccgcgcgtcgctaagatcgccttcaccggcgagacgacgaca
ggccggcttatcatgcaatatgccagccagaacctcattccggtgacgctggagctcggc
ggcaaatcgccgaacatcttcttcgccgacgtgatggcggaagacgacgacttcctcgac
aaggcgttcgaaggctttgcgatgtttgccttgaaccagggcgaagtctgcacctgcccg
agccgcgccctcgtccaggaatcgatctacgaccgtttcatggaaaaggccgtcaaacgc
gttgaggcgatcaagcagggcaacccgctcgatagcgcaacgatgatcggcgcccaggcc
tcgaccgagcagctggaaaagatcctcgcctatctcgacatcggcaagcaggaaggcgcg
gaagtgctgaccggcggctcgcgcaacgatctcggcggcgagctggcgaacggctactat
gtcaagccgacgatcttcaagggtcacaacaagatgcgcgtgttccaggaggaaatcttc
gggccggtggtttcggtgacgaccttcaagaacgagaaggaagcgctcgaaatcgctaac
gacacgctctacggcctcggcgccggcgtctggagccgcgatgccaatcgctgctaccgt
ttcggccgcgagatccaggccggccgcgtctggaccaactgctaccacgcctacccggcc
catgccgccttcggcggctacaagcagtcgggcatcggccgtgaaacccataagatgatg
ctcgaccactaccagcagaccaagaacatgctggtgagctacagcccgaaggcactcggc
ttcttctga

DBGET integrated database retrieval system