KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4163Help
Entry
Rleg_4163         CDS       T00926                                 

Definition
(GenBank) extracellular solute-binding protein family 3
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rleg_4163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlg02000]
    Rleg_4163
   02035 Bacterial motility proteins [BR:rlg02035]
    Rleg_4163
Transporters [BR:rlg02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    Rleg_4163
Bacterial motility proteins [BR:rlg02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    Rleg_4163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1
Motif
Other DBs
NCBI-ProteinID: ACS58404
UniProt: C6AZZ6
LinkDB All DBs
Position
4248626..4249399
Genome map
AA seq 257 aa AA seqDB search
MNWLKTVAAAALIQAAALLPAHAGENLAAIKSAGVFKIGTEGTYAPFTYHDESGKLVGFD
VEIGEAIAAKLGVKAEFVEGKWDGLIAGLDAKRYDTVINQVGITETRKQKYDFSEPYIAS
KAVLIARDSDDSIKSFADLKGKKSAQSLTSNFGKLATEAGAELVGTDGFDQSIQLVLTKR
ADATINDSLSFLDFKKHKPDAPVKIVAEQENADYSGVIIRKNEPELLAEINKALADIKTD
GTYKKIADKYFGQDVSK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaactggttgaaaaccgtcgccgccgccgccctcattcaggccgcggccctcctgcct
gcccatgcaggtgaaaacctcgccgccatcaaatcggccggcgtcttcaagatcggcacc
gaaggcacttatgcgcccttcacctatcatgacgaaagcggcaagctcgtcggcttcgat
gtcgagatcggcgaagcgatcgccgccaagctcggcgtcaaagccgagttcgtcgaaggc
aagtgggatggcctgatcgctggcctcgatgccaagcgctacgataccgtcatcaaccag
gtcggcatcaccgaaacccgcaagcagaagtatgatttctccgagccctatatcgcctcc
aaggccgtgctgatcgcccgcgatagcgacgacagcatcaagtctttcgccgacctgaag
ggcaagaagtccgcccagtcgctgaccagcaacttcggcaagctcgcaaccgaagccggt
gccgagctcgtcggcaccgacggtttcgatcaatcgatccagctggtgctgaccaagcgc
gccgacgccacgatcaacgacagcctctccttcctcgatttcaagaagcacaagccggac
gcgccggtgaagatcgtggccgagcaggaaaacgccgattactccggcgtcatcatccgc
aagaacgagccggagcttctcgccgaaatcaacaaggcgcttgccgacatcaagaccgac
ggcacttacaagaagatcgccgacaagtatttcggccaggatgtttccaagtaa

DBGET integrated database retrieval system