KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4762Help
Entry
Rleg_4762         CDS       T00926                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00630  Glyoxylate and dicarboxylate metabolism
rlg01100  Metabolic pathways
rlg01120  Microbial metabolism in diverse environments
rlg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg_4762
Enzymes [BR:rlg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rleg_4762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACS58991
UniProt: C6B4I3
LinkDB All DBs
Position
pR132501:complement(132334..133590)
Genome map
AA seq 418 aa AA seqDB search
MIITLTYRIETPGSVEAMAEKIASDQSTGTFVPVPGETEELKSRVAARVLAIRPLEGASH
PTWPEVGPGTPLHRADVDIAFPLDAIGTDLAALMTIAIGGVYSIKGMTGIRIVDMKLPDA
FKSAHPGPQFGIPGSRRLTGVEGRPIIGTIVKPALGLRPHETAELVGELISSGVDFIKDD
EKLMSPAYSPLKDRVAAIMPRILDHEQKTGKKVMYAFGISHADPDEMMRNHDIVAKAGGN
CAVVNINSIGFGGMSFLRKRSNLVLHAHRNGWDVLTRDPGAGMDFKVYQQFWRLLGVDQF
QINGIRVKYWEPDDSFVSSFKAVSTPLFNASDCPLPVAGSGQWGGQAPETYKRTGRTVDL
LYLCGGGIVSHPGGPAAGVRAVQQAWQAAVADIPLETYAKDHPELAASIAKFSDGKGA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgataattaccctgacctaccgtatcgaaacgcccggcagcgtcgaggcgatggcggaa
aagatcgcgagcgaccagtcgaccggcaccttcgttcccgtccccggcgagaccgaagag
ctgaaatcacgtgtcgccgcccgtgtgctcgcgatccgtccgctcgaaggcgccagtcat
ccgacttggcccgaggtcggccccggcacgccgcttcatcgcgccgatgtcgacatcgcc
tttccgctggacgcgatcgggacagaccttgcggcattgatgaccattgcaatcggcggc
gtctactccatcaagggcatgaccggcatccgcatcgtcgatatgaagctccccgacgcc
ttcaaaagcgcgcatccgggaccgcagttcggcatccccggaagccgccgcctcaccggc
gtcgaaggccggcccatcatcggaacgatcgtcaagccggcgcttggtctcagaccgcac
gaaacggcggaactcgtcggcgagctgatctcatccggcgtagacttcatcaaggatgac
gaaaaactgatgagcccggcctattcgccgctcaaggaccgcgttgcggcgatcatgccg
cgcattctcgatcacgagcagaagaccggcaagaaggtcatgtatgccttcggcatctcg
catgccgaccccgacgagatgatgcgcaaccacgacatcgtcgccaaggccggcggcaat
tgcgccgtcgtcaacatcaactcgatcggcttcggcggcatgagctttctgcgcaagcgc
tccaatctggtgctgcacgcgcatcgaaacggttgggacgtgctgacgcgcgacccgggc
gccggcatggacttcaaggtctatcagcaattctggcggctgctcggggtcgaccagttt
cagatcaacggtatcagggtcaaatattgggaaccggacgacagtttcgtctcgtccttc
aaggccgtcagcacgccgctgtttaatgcctccgattgcccgcttccggttgccggctcg
ggtcagtggggaggacaagcgcctgagacctacaagcggaccggccggacagtcgatctt
ctctatctctgcggcggcggcatcgtcagccaccccggcggcccggcggccggcgttcgg
gccgtgcagcaggcttggcaggccgcggtcgcggacatcccgttggagacctacgcgaaa
gatcatccggagctcgccgcttcgattgccaaattcagcgacggcaagggcgcatga

DBGET integrated database retrieval system