KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5983Help
Entry
Rleg_5983         CDS       T00926                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00564  Glycerophospholipid metabolism
rlg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rlg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rleg_5983
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rleg_5983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACS60744
UniProt: C6B9I6
LinkDB All DBs
Position
pR132504:complement(12471..13985)
Genome map
AA seq 504 aa AA seqDB search
MGRNIHDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PPTSVLDMRRDPAGKPLKALFSKAFEYSDGWVDDARMVVLNARDAADKGALIMPRTKVVS
AKRENGLWHIETTDTITGRNDSHQARMLVNAAGPWVDHVIRSAFGQNEAHHVRLVQGSHI
VVKKKFDDVRAYFFQNPDNRIIFAIPYEGDFTLIGTTDRDYTADPRDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLEGEGAAAPLLNVFGGK
LTTYRRLSEHALEKIGAAIGAKGAPWTAKSHLPGGDFAVKGYEAEVAKLKRRYSFLADRH
ARRLVRRYGTRAEALLGDASGIDDLGRLFGGDLYEAEVTYLVEHEWARHAEDVLWRRTKD
GLRLSKEQAQSLEEYMAAMPAMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgaaatattcacgacatattcgtcatcggtggcggcatcaacggctgcggcatt
gcgcgcgatgccgtcgggcgcggttattcggtggcgctggcggagatgaacgatttcgcc
tcgggtacctcgtcgggcgccaccaagctgatccatggcggcctgcgttacctcgagcat
tatgaattccgcctggtgcgggaatcgctgatggagcgcgagatcctctgggcgatggcg
ccgcacatcatctggccgctgcgtttcgtattgccctaccacaagggcggcatccgtccg
gcctggctgatccggctcggcctcttcctctacgaccatcttggcggccgcaagctgcta
ccgccgacatccgttctcgacatgcgccgcgatccggccggcaagccgctgaaggcgctg
ttttccaaggctttcgaatattccgacggctgggtcgacgatgcccgcatggtggtgctg
aacgcccgcgatgccgccgacaagggggcgctgatcatgccgcgcaccaaggtggtgtcg
gcaaagcgcgagaatggcctatggcatatcgagaccaccgataccatcaccggtcgcaat
gacagccatcaggctcggatgctggtcaatgccgccggtccctgggtcgaccatgtcatt
cgttccgccttcggccagaacgaagcccaccatgtccgcctcgtccagggcagccatatc
gtcgtgaagaagaagttcgacgatgtgagagcctatttcttccagaaccccgacaaccgg
atcatcttcgccatcccctacgagggcgacttcaccctgatcggcaccacggatcgcgac
tacaccgccgatccccgggatgtccggatctccgaggaggagaccgtctacctttgcaat
gcggcgtcggaatatttcaaggagccggtcaggccggaggatatcgtctggacctattct
gcggtcaggccactttatgatgacggcgcctcgaaggcgcaggaggcgacgcgcgactat
gtgctgaagctggaaggcgaaggtgccgcggcgccactgctcaacgtcttcggcggcaag
ctcaccacctatcgccggctttccgaacatgcgctggagaagatcggcgctgcgatcggc
gccaaaggcgccccgtggacggccaaaagccatctgccgggcggcgatttcgcggtcaag
ggttacgaggcggaggtcgccaagctgaagcggcgttattcgttcctcgccgatcggcat
gcccgccggctggtgcgccgctatggcaccagggccgaggcgctgcttggcgatgccagc
ggcatcgacgatctcggacggctgttcggcggcgatctctacgaggcagaggtcacctat
ctcgtcgaacatgaatgggcccggcacgccgaagacgtgctgtggaggagaacaaaggat
ggtctgcgcctttcgaaggagcaggcccagtcactggaggagtacatggctgccatgccg
gcgatggccgggtag

DBGET integrated database retrieval system