KEGG   Roseobacter litoralis: RLO149_c000090Help
Entry
RLO149_c000090    CDS       T01572                                 

Definition
(GenBank) uracil DNA glycosylase-like protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
rli  Roseobacter litoralis
Pathway
rli03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rli00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    RLO149_c000090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rli03400]
    RLO149_c000090
Enzymes [BR:rli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     RLO149_c000090
DNA repair and recombination proteins [BR:rli03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     RLO149_c000090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4130 UDG
Motif
Other DBs
NCBI-ProteinID: AEI92043
UniProt: F7ZD35
LinkDB All DBs
Position
9686..11119
Genome map
AA seq 477 aa AA seqDB search
MPHVTLPRIGTAQAWRDAARGFLNAHIPPEQITWGDSTTEPGLFETLVPTFVPGTATVPR
SFVSMANTIVWHSDPSRFARLYAFLWRLKDTPHLMTDRGDAQLAKLRAMEKNVRRCQHKM
KAFVRFREISAPEDNRRSFAAWFEPTHHTIEPTAQFFARRFADMDWRILTPDVSVFFENG
NMRFAEDQPKPELPADASETLWVTYFRNIFNPARLKVRAMQSEMPKKYWKNMPEAAAIPD
LIATAPERARQMALAAPTLPPARIGAIQAQQASYESVWDGPPGSLPQAIAGCTRCPLHKT
ATQAVPGEGPIDARLMIVGEQPGDQEDLIGRPFVGPAGQLFDRIAADVGLDRGQVFITNA
VKHFKFVPRGRKRIHQRPNQGEVAHCKWWLDAELRQVAPDLVVAMGATAAAALTGSGKAI
SARRGRIEIGQAGISVLITWHPSYLLRLTDDAAREAATLELAGDLHAALRYETHLQN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgccccatgtcaccttgccacgcattggaacagcacaggcatggcgcgacgctgcacgc
gggtttttaaacgcgcacataccgcccgagcagatcacatggggcgacagcacaaccgaa
ccgggccttttcgagacgctggtgccgacctttgtgccgggaaccgcgactgtaccgcgg
tcttttgtctcaatggccaataccatcgtctggcatagcgatccatcccgatttgcgcgg
ctttacgcgtttttgtggcggttgaaagacacgccgcacctgatgacggatcggggtgac
gcgcagctggcgaagctcagagccatggaaaaaaacgtgcgccgctgccagcacaagatg
aaagcctttgtgcggttccgggaaatcagcgcgcctgaggacaacagacggtcctttgcc
gcttggtttgagccaacgcatcataccattgaacccaccgcgcagttttttgcgagacgt
ttcgcggatatggattggcgcattctgacaccggatgtgtcggtcttttttgagaacggg
aatatgcgctttgctgaagaccagcccaaaccggagcttcccgcagatgcaagcgaaacg
ctctgggttacgtattttcggaacatctttaaccctgcccggctcaaggtgcgggcaatg
caatcagaaatgcccaagaaatattggaaaaacatgcctgaggctgcggctattccggac
ctgatcgccaccgccccggaaagggcgcgtcagatggccttggccgcgcccactttgccg
cccgcgcgcattggggctattcaggcgcagcaggcaagctacgaaagtgtttgggacggc
ccgccgggatcgctgcctcaggccatcgctggttgcacgcgttgcccgttgcacaaaacc
gcgacgcaagcggttcccggcgagggtccgattgatgcgcggctgatgattgtcggtgag
cagccgggtgatcaagaggatctgatcgggcggccctttgtaggacctgcgggtcagctt
tttgaccggatcgcggctgatgtcgggttggacagagggcaggttttcatcaccaatgcc
gtgaaacatttcaaatttgtgccgcgcgggcgcaaacgtatccaccagcgccccaatcag
ggcgaggtcgcccattgcaagtggtggctggacgctgaactgcggcaggttgcgcccgat
ctggtggtggccatgggtgctactgcggctgctgcgttgaccggttcgggcaaagcgatt
tcagcgcggcgtggcagaattgaaatcggtcaggcggggatttcggtgctgatcacctgg
cacccttcttacctgttacgtctgacagatgatgctgcgcgtgaagctgcaacgctcgaa
ttggctggcgatttgcacgcggctttgcgctatgaaactcacctacagaactga

DBGET integrated database retrieval system