KEGG   Roseobacter litoralis: RLO149_c014180Help
Entry
RLO149_c014180    CDS       T01572                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rli  Roseobacter litoralis
Pathway
rli00010  Glycolysis / Gluconeogenesis
rli00020  Citrate cycle (TCA cycle)
rli00620  Pyruvate metabolism
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01120  Microbial metabolism in diverse environments
rli01130  Biosynthesis of antibiotics
rli01200  Carbon metabolism
Module
rli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RLO149_c014180 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RLO149_c014180 (pdhC)
   00620 Pyruvate metabolism
    RLO149_c014180 (pdhC)
Enzymes [BR:rli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RLO149_c014180 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEI93415
UniProt: F7ZEY4
LinkDB All DBs
Position
complement(1453519..1454808)
Genome map
AA seq 429 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDVVASGDIMAEIETDKATMEFEAVDEGTIGKIL
IEEGSEGVKVNTPIAVLLEDGESADDISSAPAATPAAAEAPAPAADPAPAATPAPAAPQS
SDGSRIFASPLARRIAANNGVDLATVNGSGPHGRIVKADVEGLSASAAAPAKAAPAPAAA
APVVASGPAAEAVMAMYEGRAYEEISLNGMRKTIAARLTEAKQSIPHFYLRRDIELDALL
AFRGQLNKQLESRGVKLSVNDFIIKACALALQTVPDANAVWAGDRMLKLTPSDVAVAVAI
EGGLFTPVLKDAEMKSLSALSAEMKDLAARARDRKLAPHEYQGGSFAISNLGMFGIDNFD
AVINPPHGAILAVGAGVKKPIVGKDGELGVATVMSVTLSVDHRVIDGALGAQLITAIKEN
LENPMTMLA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccgaaatactcatgcccgccctgagcccaaccatggaagaaggcacattggcc
aaatggctggtgaaagagggcgatgtggttgcctctggcgatatcatggccgagatcgaa
accgacaaggcaacaatggaattcgaagccgtcgacgaaggaacgattggcaaaatcctg
atcgaagaaggcagcgaaggggtgaaagtgaacacgccgattgcggtacttctggaagac
ggtgaaagcgcggacgatatctcttcagcaccggctgcaacacccgccgctgctgaagcg
cctgcacctgcggccgatccggcaccggctgcaacgcctgcgccagcggcaccgcaatct
tcagatgggtcgcggattttcgcgtctcccttggcgcgtaggatcgcagcaaacaatggc
gttgatctggccacggtcaatgggtccggcccacatggacggatcgtcaaggcagatgtc
gaaggtctcagcgcgagtgctgcggcccctgctaaggccgcgcccgccccagcggcggca
gcgcccgtggtagcatcgggtcccgccgccgaagcggtgatggcgatgtatgaaggacgc
gcctatgaggagatcagcctgaacgggatgcgcaagacaattgccgcgcgtctgaccgaa
gccaaacaatcgattccgcatttctatctgcggcgcgacattgaacttgatgcgctgttg
gcgttccgggggcagttgaacaaacagttggaaagccgtggcgtgaaactgtcggtcaat
gattttatcatcaaggcctgcgccttggccctgcaaaccgtgccagacgcgaacgcagtg
tgggccggggaccggatgctgaaactcacaccttccgacgtggcagttgccgttgctatc
gagggcggcttgttcacgccggttctcaaggacgccgagatgaaatcactctcagcactg
tccgcagagatgaaagacctcgcggcgcgcgcgcgggaccgcaagctcgcacctcatgaa
tatcagggcggcagctttgcaatttccaaccttggcatgttcggcatcgacaatttcgat
gctgtgatcaacccaccccatggcgcgatcctcgcggtcggtgctggcgtgaaaaaacct
atcgttgggaaagatggtgaacttggcgttgcaaccgtgatgtccgtcacattgtcagtg
gatcacagggtgattgacggtgctttgggcgcgcaactcatcacggcaatcaaggagaac
cttgagaatccgatgacaatgttggcctga

DBGET integrated database retrieval system