KEGG   Roseobacter litoralis: RLO149_c022350Help
Entry
RLO149_c022350    CDS       T01572                                 

Definition
(GenBank) putative aminomethyltransferase
  KO
K17486  dimethylsulfoniopropionate demethylase [EC:2.1.1.269]
Organism
rli  Roseobacter litoralis
Pathway
rli00920  Sulfur metabolism
rli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    RLO149_c022350
Enzymes [BR:rli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.269  dimethylsulfoniopropionate demethylase
     RLO149_c022350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C DUF2085
Motif
Other DBs
NCBI-ProteinID: AEI94210
UniProt: F7ZAL4
LinkDB All DBs
Position
complement(2291232..2292335)
Genome map
AA seq 367 aa AA seqDB search
MALISPSRRLRRTPFSDGVEAAGVKAYTVYNRMLLATVFESVEADYRHLKEHVQVWDVSV
ERQVELRGPDAARLMQMLTPRDLRGMLPGRCFYIPIVDETGGMLNDPVAVKLAEDRWWIS
IADSDLLLWVKGISNGYRLDVLIDEPDVSPLAIQGPKADELAARIFGDSIRDIKFFRFGL
FAFEGREMVVARSGYSKQGGFEVYVEGADIAMPLWDALFKAGEDLNVRAGCPNGIERIEG
GLLSYGNDMTDDNTPHECGLGRFCDTQTAIGCIGRDALLRVAKEGPVQQIRAIAVEGDQL
PLCDRAWGLYAGDTRVGQLTSAAWSPDHQTNVAIGMVRMTHWDTGTKLRVETPDGAREAT
VQAGFWH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcacttatctctccatcgcgcagactacgccgcacacctttttctgatggtgtggag
gccgcaggggtcaaggcctacacggtctacaacaggatgctactggcaaccgtttttgaa
agcgtggaggctgactaccgtcacctcaaggaacatgtgcaggtctgggatgtctcggtc
gagcgtcaggtcgaactgcgcggcccggatgcggcccgcctgatgcaaatgctgaccccg
cgcgatctgcgtggcatgttgccggggcggtgcttttacatcccgatcgtggatgagaca
ggcggcatgctcaatgacccggtggcggtcaaactggcagaagatcgctggtggatttcc
attgcggacagtgatctgctgttgtgggtcaaggggatatccaatggctatcggctggat
gtgctgattgatgaacccgatgtcagcccgctggccattcagggtcctaaggcggacgag
ctggccgcccgtatctttggcgacagcatccgtgacatcaagtttttccgctttggtctc
tttgcatttgaagggcgtgaaatggtggtggcgcgttcgggctattccaaacagggcggt
tttgaggtctatgtcgagggcgcagatatcgcgatgccgctatgggatgcgctgttcaag
gcgggcgaggacctgaatgtgcgggcagggtgccccaatggcattgaacggatcgagggc
ggattgctgtcttatggcaacgacatgacggatgacaacacgccacatgaatgcgggctt
gggcgcttttgtgatacacagacggccatcggctgtatcggtcgggatgccttgttgcgc
gtggccaaggaaggcccggtccaacaaatcagagcgattgcggtcgaaggcgaccagttg
ccgctgtgtgaccgtgcctgggggctctacgccggtgatacgcgggtcgggcagctcaca
tctgccgcctggagcccggatcatcagaccaatgtcgccatcggcatggtgcgcatgacc
cattgggataccggcaccaagctgcgcgttgaaacgccggatggcgcgcgcgaggcgacc
gtgcaggccggtttctggcactga

DBGET integrated database retrieval system