KEGG   Roseobacter litoralis: RLO149_c024320
Entry
RLO149_c024320    CDS       T01572                                 

Gene name
ung
Definition
(GenBank) uracil-DNA glycosylase Ung
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
rli  Roseobacter litoralis
Pathway
rli03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rli00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    RLO149_c024320 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rli03400]
    RLO149_c024320 (ung)
Enzymes [BR:rli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     RLO149_c024320 (ung)
DNA repair and recombination proteins [BR:rli03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     RLO149_c024320 (ung)
 Prokaryotic type
     RLO149_c024320 (ung)
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-ProteinID: AEI94400
UniProt: F7ZC14
LinkDB
Position
2491847..2492503
AA seq 218 aa
MKRLGAWRALPFFADTWPDICDVLKNETAPVLPPADDIFAAFARTQPQQTRVVILGQDPY
PTPGHAHGFAFSASAQTRPLPRSLSNIFKEMEADLGAAPPHADLRFWADQGVLLLNTALS
VRAHDAGSHAKIGWHVLTQQVLAHLDDQPRAFLLWGAHAQKAARDVDPIRHLKLETAHPS
PLSARRGFFGSRPFSRVNDWLQAQGHQAINWSNPPEAP
NT seq 657 nt   +upstreamnt  +downstreamnt
ttgaagagactgggggcatggcgcgcgctgcccttttttgcagatacatggccggacata
tgcgacgttctcaagaatgagaccgcgccggtattaccgcctgcagatgacatctttgcc
gcttttgcgcgcacccagccgcagcaaacgcgcgtcgtgatccttggtcaggacccctat
ccgacacccggtcacgcccatgggtttgccttttccgccagcgcccaaacacgccccttg
cccagatcgctgtccaacatcttcaaagagatggaagcggacctcggtgccgcgcccccg
catgccgatctgaggttttgggccgatcagggcgttttgcttttgaacacggcgctgagc
gtccgcgcccatgatgccgggtcacatgcaaagatcggatggcatgtcctgacgcaacag
gtgctcgcacatcttgatgatcagccgcgcgcttttctgctgtggggagcgcatgcgcaa
aaagcggcgcgcgatgttgatccgatccgtcatctgaagctagagaccgcgcatccttcg
cccctgtctgcgcggcgtggctttttcggctcacgccccttcagtcgcgtgaatgactgg
ttgcaggcgcagggccatcaggccataaactggagcaatccgccggaggcaccatga

DBGET integrated database retrieval system