KEGG   Roseobacter litoralis: RLO149_c025670Help
Entry
RLO149_c025670    CDS       T01572                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rli  Roseobacter litoralis
Pathway
rli00473  D-Alanine metabolism
rli00550  Peptidoglycan biosynthesis
rli01100  Metabolic pathways
rli01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rli00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RLO149_c025670 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RLO149_c025670 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RLO149_c025670 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rli01011]
    RLO149_c025670 (ddl)
Enzymes [BR:rli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RLO149_c025670 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rli01011]
 Precursor biosynthesis
  Amino acid ligase
   RLO149_c025670 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N NAD_binding_8 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEI94535
UniProt: F7ZDD3
LinkDB All DBs
Position
complement(2633170..2634090)
Genome map
AA seq 306 aa AA seqDB search
MGQSSRTPPKVAVLLGGPSVEREVSLSSGQACAAALRDEGYDVVEIDAGQHLGARLIDVG
PDAVLNCLHGRWGEDGCVQGLLEWMGVPYSHSGVLASALAMDKQRSKEAFVAAGLPVVPS
VIAKAADVRIGHVMQPPYVVKPNNEGSSVGVYLVHEAANGPPQLSEDMPQEVMVEAFAPG
RELTTTVVGDRPLTVTDIVTDGWYDYDAKYKPGGSHHVVPADIPADIFDMCMDYALRAHH
ALGCRGVSRTDFRWDETKGAAGLILLETNTQPGMTATSLSPEQAAATGMPFGKLCAWMVE
DASCDR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcagtcgagcaggacacccccgaaagtggcagtattattgggcggaccttcggtt
gaacgcgaagtgtcgctgtccagtgggcaagcctgcgctgccgctttgcgggacgaagga
tatgacgtcgtcgaaattgacgcgggccagcatcttggcgcgcgtttgatcgacgtgggc
ccggatgccgtcttgaattgcctgcatggtcgttggggcgaagatggttgcgtgcagggc
ctactggagtggatgggcgtgccctatagccactccggtgttctggcctccgccctcgcg
atggacaagcagcgcagcaaagaggctttcgtcgcggcaggcttgccagtggtcccgagc
gtcatcgccaaggcggccgatgtgcgtataggccatgtgatgcagcccccctatgtggtc
aaacccaataacgaagggtcctccgtgggcgtttacctcgttcatgaggccgcgaacggc
ccgccacagctctcggaggatatgccacaagaggtcatggtcgaagcctttgccccgggg
cgtgaattgaccacaacggtggtgggggatcgaccgctgaccgtcaccgacatcgtgaca
gacggctggtatgactatgatgccaaatacaaacccggtgggtcccatcacgttgtgcct
gcggatattcctgccgatatctttgatatgtgcatggattatgccctgcgcgcgcatcat
gccttgggctgtcgcggtgtcagccgcacggatttccgatgggatgaaacaaagggtgcc
gcgggcctgatcctgcttgagacaaacacgcagccgggcatgacggccacgtcgctttcg
cctgagcaggcagcggccacgggcatgccctttggcaagctctgcgcgtggatggtggag
gacgcctcatgcgaccgttga

DBGET integrated database retrieval system