KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0033Help
Entry
Rleg2_0033        CDS       T00779                                 

Definition
(GenBank) Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))., Phosphate acetyltransferase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00620  Pyruvate metabolism
rlt01100  Metabolic pathways
rlt01120  Microbial metabolism in diverse environments
rlt01200  Carbon metabolism
Module
rlt_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rleg2_0033
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Rleg2_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ACI53336
UniProt: B5ZMZ5
LinkDB All DBs
Position
33368..35653
Genome map
AA seq 761 aa AA seqDB search
MPDIDKKDRPATSVTDQEALDFHATGRPGKLEVVPTKPMATQRDLSLAYSPGVAVPVKAI
AADPQTAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGKAVLFKRFADVDSIDLE
IDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFVIESRLRELMDIPVFHDDQHGTAIIA
AAGLINALELTGRDLKTTKLVCNGAGAAAIACIELIKAMGFAPENIILCDTKGVIYQGRT
EGMNQWKSAHAAKTDTRTLEEAMDGADVVFGLSQKGAFSAEMIRSMADRPIIFAMANPDP
EITPEEVARIRDDAIMATGRSDYPNQVNNVLGFPYIFRGALDVRASTINDAMKIAAVKAL
ANLAREDVPDDVVAAYQGNRPRFGSQYIIPVPFDPRLISAIPVAVAEAAIETGVARKVIT
DMAGYARELSARRDPIASTLASLYERVRRRPKRIVFAEAEEEQVLRAALSYANQQLGTAI
LLGREDLIRSTAERAGIDLNRPGLEIVNARISTRVEAYIDYLYARLQRHGYLHRDVQRLI
HNDRNHFAATMVALGDADGMVTGITRNYSTALEDVRRCIDEKPGHRVIGVSLALCRGRTV
FVADTAVHDMPTAEQLADIAEEAAGLARRMGYQPRVAMLAYSTFGHPSGERSERVREAVK
ILDKRRVDFEYDGEMAADVALNRKVMEQYPFCRLSGPANVLVMPAFHSASISTKMLQELG
GSTVIGPILVGLDKPVQITSMGAKDSDIVNMAAIAAYGAGS
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatatcgataagaaagaccggccggcgacatcagttactgaccaggaggcgctc
gattttcacgccacgggccggcccggcaaactggaagtcgtcccgaccaagccgatggcg
acgcagcgcgacctgtcgcttgcctattcgccgggtgtcgccgtgcccgtcaaggcgatc
gccgccgatccgcagacagcttacgattacaccgcccgcggcaatatggttgccgtcatt
tccaacggcacggcgatcctcggtctcggcaatctcggcgcgctggcctccaagcccgtg
atggaaggcaaggcggtgctgttcaagcgcttcgccgacgtcgattcgatcgacctcgaa
atcgatacggaaaatgtcgacgagttcatcaactgcgtgcgcttcctcggcccctccttc
ggcggcatcaacctcgaggatatcaaagcgccggattgtttcgtcatcgaaagccggctg
cgcgagctgatggacatcccggtcttccacgacgaccagcacggaacggcgatcatcgcc
gccgccggcctgatcaacgcgctggaactgaccggccgcgacctgaagacgaccaagctt
gtctgcaacggcgccggtgctgcggcgatcgcctgtatcgagctcatcaaggcgatgggc
tttgcgccggaaaatatcatcctctgcgacaccaagggcgtcatctatcagggccgcacc
gagggcatgaaccagtggaaatcggcgcatgcggcaaagaccgatacacgcacgcttgag
gaggcgatggacggcgctgacgtggttttcggcttgtcgcagaagggcgccttctcggcc
gagatgatccgctcgatggcggatcggccgatcatcttcgccatggccaatcccgatccc
gaaatcaccccggaagaggtggcccgcatccgcgacgacgccatcatggcgaccggccgc
tcggactacccgaaccaggtcaacaacgtcctcggctttccctatatcttccgcggcgct
ctcgacgtccgcgcttccaccatcaacgacgcgatgaagatcgccgcggtcaaggcgctg
gcaaatcttgcccgcgaggatgtgccggatgacgtggttgccgcctatcagggcaaccgg
ccgcgcttcggctcgcaatacatcatcccggttcctttcgatccgcggctgatctcggcg
atcccggtcgcggtcgcggaagcggcgatcgaaaccggcgtcgcccgcaaggtcatcacc
gacatggcgggttatgcccgcgagctttcggcgcgacgcgatccgatcgcctcgacgctt
gccagcctgtatgagcgggtgcgccgccgcccgaagcggatcgtctttgccgaggccgag
gaagaacaggtcctgcgcgcagcactctcttacgccaaccagcagctcggcaccgccatt
ctgctcggccgtgaggacctgatccgatcgacggccgaacgcgccggcatcgatctcaac
cggccggggctggaaatcgtcaatgcccgtatttccacccgggtcgaggcctatatcgac
tatctctatgccaggctgcagcggcacggttatctccaccgcgacgtccagcggctgata
cacaacgaccgcaaccacttcgccgccactatggtggcgctcggcgatgccgacggcatg
gtgacgggcatcacccgcaactattcgacagcacttgaggatgtgcgccgctgcatcgat
gaaaagcctggccaccgcgtcatcggtgtctcgttggcgctctgccgcggccgcacggtc
ttcgtggccgataccgcggtgcatgacatgccgacggccgagcagcttgccgatatcgcc
gaggaggccgccggtctggcacggcgcatgggttatcagccgcgcgtcgccatgcttgcc
tattccaccttcggccatccctccggcgaacgctccgagcgggtgcgcgaggcggtaaag
atcctcgacaagcgccgcgtcgatttcgaatatgacggtgaaatggccgccgatgtggcg
ctgaaccgcaaggtgatggagcaatatcccttctgccgcctctcgggtcccgccaacgtg
ctggtcatgccggctttccactcggcctcgatctcgaccaagatgctgcaggaactcggc
ggctcgacggtgatcggcccgatcctcgtcggtctcgacaaaccggtgcagatcacctcg
atgggcgccaaggatagcgacatcgtcaacatggcggcgatcgccgcctatggcgcgggt
tcgtaa

DBGET integrated database retrieval system