KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0270Help
Entry
Rleg2_0270        CDS       T00779                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACI53569
UniProt: B5ZPQ2
LinkDB All DBs
Position
274394..275404
Genome map
AA seq 336 aa AA seqDB search
MRAVRLESIGSLTMRSVERPVAGRGELLVRVAAAGICGSDRHMYKGEYPTAIPVTLGHEF
CGIVEEIGDGVTRFAGGELVTVDPNIACGTCPACTRARPNLCERLTAIGVTRDGGFAEYV
AVPHAQAFILPVGLDPVHGAFSEPLACCIHAIDKAGIRPGDNVAILGGGVIGLLMVQLAR
LAGAGEIILITRQQSRRQAALRLGVTHAFDPNSSDTVASVREVTKGGADVVIECAGVSDT
LQSGLKMARRGGAFVLFGVTPAGVEVPVLPFDLLINEVDIRPAYLNPFTHSRAAAMVASG
ALELDALVTRTIGLEEVADVVVNAPLPGEIKVIVRP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgtacgcttggagtcgatcgggtctttgaccatgcgcagcgttgagagaccg
gttgccgggcggggcgagctgcttgtccgggtcgcggccgccggcatctgcggttccgat
cgccacatgtacaagggcgaatatccgacagcgatccccgtcacgctgggccacgaattc
tgcggcatcgtcgaagagatcggcgatggcgtcacccgctttgccggcggcgagttggtg
acggtcgacccgaatatcgcctgcggcacctgtccggcttgcacacgggcgcggccgaac
ctatgcgagagactgaccgccatcggcgtgacgcgggatggtggctttgccgaatatgtg
gcggtgccgcatgcgcaggccttcatcctgccggtcggcctcgatcccgttcacggcgcc
ttttccgaaccgttggcctgttgcatccacgccatcgacaaggcaggaatccgccctggc
gacaacgtcgccatcctcggcgggggcgtgatcggcctgctgatggtgcagctggctcgt
ctggcgggggcaggcgagatcattttgatcacgcggcagcaatcgagacgtcaggccgct
ctgcgcctgggggtgacgcacgccttcgacccgaattcttcggacacggtcgcgtccgtt
cgagaggtcaccaagggcggcgccgatgtggtcatcgagtgcgccggcgtcagtgacacg
cttcaaagcggtctgaagatggcgcggcgcggtggcgccttcgtgcttttcggggtcacg
cctgcgggtgtcgaggtgccggttctgcctttcgatctgctgatcaacgaagtcgatatc
aggccggcctacctcaaccccttcacccattcgcgcgctgcggcaatggtcgcaagcgga
gcattggaactggacgcattggtcaccagaaccatcggtctcgaagaggtcgccgacgtg
gtggtcaacgcgccattgccaggcgagatcaaggtcatcgtccggccttag

DBGET integrated database retrieval system