KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0845Help
Entry
Rleg2_0845        CDS       T00779                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Rleg2_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACI54139
UniProt: B5ZUN0
LinkDB All DBs
Position
863256..863858
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS
FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGA
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDYVLERYEEATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcctgaacttccctatgattacgaagcgcttgctcccttcatgtcg
aaggaaacgctggagtttcatcacgacaagcaccataaggcctatgtcgacaacggcaac
aagctcgccgccgaagccggtctttcggatctgtcgctcgaagacgtcgtcaagaagtcc
ttcggcaccaatgccggcctcttcaacaacgctgcccagcactacaaccacatccatttc
tggaagtggatgaagaagggcggcggcggcaacaagctgccgggcaagctcgaagcggct
ttcgcctccgatctcggcggctatgacaagttcaaggccgatttcgccaatgccggcgcc
acccagttcggctcgggctgggcctgggtttccgtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctcgtccacggcgccaccccgatcctcggcgtcgac
gtctgggaacactcctattacatcgactatcgcaacgctcgcccgaaatacctcgaggcc
ttcgtcgatagcctgatcaactgggattacgtcctggagcgctacgaagaagccacgaag
taa

DBGET integrated database retrieval system