KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_0910Help
Entry
Rleg2_0910        CDS       T00779                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rleg2_0910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rlt02000]
    Rleg2_0910
Enzymes [BR:rlt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rleg2_0910
Transporters [BR:rlt02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rleg2_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4 GST_C_6 Tom37 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ACI54204
UniProt: B5ZVE5
LinkDB All DBs
Position
925983..926594
Genome map
AA seq 203 aa AA seqDB search
MKLYHHPLSGHSHRVHLFLSLLGVPYELVEVDLSARAHKAPEFLKLNPFGQVPVLDDEGT
VIADSSAILVYLARKYGRTDWLPEQALAAARIQKWLSVAAGEIAYGPCAARLVTVFGADF
RADEVIARAHRILALIEAELAGRNFLLGDNPVIADVALYSYIANAPEGNVDISAYPSVRA
WLARIEALPGFVGFRKTKIGLAA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctaccatcacccgctttccggccattcgcaccgggttcacctgtttctgtcg
ctgctcggcgtgccctatgagctggtcgaggtcgatctgtcggcgcgcgcccacaaggcg
ccggaatttctgaagctcaaccccttcggccaggtgccggtcctcgacgacgagggcacg
gtcattgccgattcttctgccatcctcgtctatctcgcgcgcaaatatggccgcaccgac
tggctgccggaacaggcattggccgcggcgcgaatacagaaatggctctcggttgctgct
ggtgagatcgcctacggaccgtgcgccgcccgcctggttaccgttttcggcgccgatttc
cgcgccgatgaggtgatcgcccgggcgcaccgcattctggcgctgatcgaggcggagctc
gccggccgcaatttcctgctcggcgacaatcccgtcatcgccgacgtcgcgctctacagc
tacatcgccaatgcgccggagggcaatgtcgacatctcggcctatccgagcgtccgcgcc
tggcttgcccgcatcgaggcgctgccgggtttcgtcggctttcgcaagacgaagatcggc
cttgccgcatga

DBGET integrated database retrieval system