KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1315Help
Entry
Rleg2_1315        CDS       T00779                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rlt03012]
    Rleg2_1315
   03029 Mitochondrial biogenesis [BR:rlt03029]
    Rleg2_1315
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rlt04147]
    Rleg2_1315
Translation factors [BR:rlt03012]
 Eukaryotic Type
  Elongation factors
   Rleg2_1315
 Prokaryotic Type
   Rleg2_1315
Mitochondrial biogenesis [BR:rlt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Rleg2_1315
Exosome [BR:rlt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rleg2_1315
  Exosomal proteins of breast cancer cells
   Rleg2_1315
  Exosomal proteins of colorectal cancer cells
   Rleg2_1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACI54609
UniProt: B5ZYR8
LinkDB All DBs
Position
1341735..1342910
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRATSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVNRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVAVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgagcgcaacaagccgcacgtcaacattggcacgatcggccac
gttgaccacggcaagacgtctctgacggcagcgatcacgaagtacttcggtgagttcaag
gcgtacgaccagatcgacgctgctccggaagaaaaggcccgcggcatcaccatttcgacg
gcgcacgtcgagtatgagacgccggcccgccactacgcccacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtg
tgctcggccgctgacggcccgatgccgcagacgcgcgaacacatcctgctggcccgccag
gtcggcgttccggcgatcgttgtgttcctgaacaaggtcgaccaggttgacgacgccgag
cttctcgaactggtcgagctcgaagttcgcgaactgctgtcgtcctacgacttcccgggc
gacgatatcccggtcgtcaagggttcggctcttgctgctcttgaagattctgacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggttgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgcggcacggttgtgaccggccgcgtcgagcgtggcattgtcaaggttggcgaagaagtc
gagatcgtcggcatccgcgcgacctcgaagacgacggtgaccggcgttgaaatgttccgc
aagctgctcgatcagggccaggccggcgacaacatcggcgcactggttcgtggtgtgaac
cgtgacggcgtcgagcgtggccagatcctgtgcaagccgggctctgtcaagccgcacaag
aagttcatggcggaagcctacatcctgacgaaggaagagggtggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggatgtgaccggcatcgtgacg
ctgcctgagggcaccgagatggtcatgccgggcgacaacgtcacggttgccgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgcaatccgcgaaggcggccgcacc
gtcggcgccggtatcgttgcttcgatcgtcgagtaa

DBGET integrated database retrieval system