KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_1528Help
Entry
Rleg2_1528        CDS       T00779                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
rlt00970  Aminoacyl-tRNA biosynthesis
rlt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rleg2_1528
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rlt03029]
    Rleg2_1528
Enzymes [BR:rlt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Rleg2_1528
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Rleg2_1528
Mitochondrial biogenesis [BR:rlt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rleg2_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: ACI54818
UniProt: B5ZMJ6
LinkDB All DBs
Position
1553731..1555233
Genome map
AA seq 500 aa AA seqDB search
MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD
AAMPGMLPVINEECVRQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG
EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSLHDQHATMSYVDLNRSGVALMEIVS
KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEGFGTRCEIKNV
NSIRFIGQAIEYEARRQIGILEDGGTIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD
LLPLEFDDAFVSALAVDLPELPDDKKERFVRELGLSIYDASVLVSEKAIADYFEAVAAGR
DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLT
EGGDPAEIVDARGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTLAAWFVGQVMKATG
GKANPQAVQALVKAKLGIEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgtcgacgtccgcacgcctgatccgaaacgcttcatccccggcgccaccggc
gactgggaagtcatcgtcggcatggaagtccatgcccaggtgctgtccaattcgaagctc
ttctccggcgcctcgacggaattcggcaagccacagaattccaacgtctcgctggtcgat
gccgccatgcccggcatgctgcctgttatcaacgaggaatgcgtcaggcaggccgtgcgc
accggtctcggcctcaaggcccagatcaacaagcgctcgctcttcgaccgcaagaactat
ttctatcccgacctgccgcagggctatcagatctcgcagttcaaggatccgatcgtcggc
gagggcaagatcgtcatttcgctcgggccggaccgccaaggccagttcgaggatatcgag
atcggcatcgagcgcctgcacctggagcaggatgccggcaagtcgctgcatgaccagcat
gcgaccatgtcctatgtcgatctgaaccgctccggcgtcgcgctgatggagatcgtctcc
aagcccgacatgcgctcgtccgacgaagccaaggcctatatgaccaagctgcgttcgatc
gtgcgttatctcggcacctgcgacggcaacatggacgaaggttcgatgcgcgccgacgtc
aacgtctccgtccgccgcccgggcgaaggtttcggcacgcgctgcgagatcaagaacgtc
aactccatccgcttcatcggccaggcgatcgaatatgaagcccgccgccagatcggcatt
ctggaagatggcggcacgatcgagcaggagacgcggttgttcgacccgaacaagggcgag
acacgttcgatgcgctccaaggaggatgcgcacgactatcgttatttccccgatccggac
ctgctgccgctcgagttcgacgatgccttcgtctcagcactcgcagtcgatctgccggaa
ttgcctgacgacaagaaggagcgcttcgtgcgcgagctcggcctgtcgatctacgacgcg
tcggtgctcgtttccgaaaaggcgatcgccgattatttcgaagccgtggccgcgggccgt
gacggcaagacggcggcaaactgggtgatcaacgatctgctcggcgcgctgaaccgcacc
ggcaaggatatcgagcagacgccggtttcgccggcccagctcggcgccatcatcgatctg
atcaaggctggcaccatctccggcaagatcgccaaggatctcttcgagatcgtgctgacc
gagggcggtgatcccgccgagatcgtcgacgcgcgcggcatgaagcaggtgaccgatacc
ggcgccatcgagaaggccgtggacgagatcatcgccgccaatcccgatcaggtggaaaag
gtcaaggcgaagccgaccctggccgcatggttcgtcggccaggtgatgaaggcgaccggc
ggcaaggccaatccgcaggccgtccaggcgctcgtcaaggcaaagctcggcatcgaggaa
taa

DBGET integrated database retrieval system